DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and AT4G14090

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_193146.1 Gene:AT4G14090 / 827046 AraportID:AT4G14090 Length:456 Species:Arabidopsis thaliana


Alignment Length:353 Identity:76/353 - (21%)
Similarity:139/353 - (39%) Gaps:100/353 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PVIALSSCAIMPWHYKRMGSPFINPIMPMNFLPYT----DEMSLIDRLNNFFHFHTVNTLYN--- 213
            |:..:....::||         ::.:.....||.|    :..:::|     .:::..||.|.   
plant   113 PITGVIYSVLVPW---------VSTVAREFHLPTTLLWIEPATVLD-----IYYYYFNTSYKHLF 163

  Fly   214 -----------MIT--------QPA---TDALIAER---------FGPGLPPINEIVKNTSLMLI 247
                       :||        ||:   ..||:..|         ..|      :|:.||...| 
plant   164 DVEPIKLPKLPLITTGDLPSFLQPSKALPSALVTLREHIEALETESNP------KILVNTFSAL- 221

  Fly   248 NQHYALTGPRPYAPNVIEVGGLQVGPIKPLPQHLLDL---------------LDRSPNGVIYISW 297
             :|.|||       :|.::..:.:||:....:...||               |:||   |||||.
plant   222 -EHDALT-------SVEKLKMIPIGPLVSSSEGKTDLFKSSDEDYTKWLDSKLERS---VIYISL 275

  Fly   298 GSMVNSNTLPSGKRSALFQSI-SQLKEYNFVMRWKSLESLEDKQPSNL-------YTFDWLPQRD 354
            |:  :::.||.....||...: :..:.:.:::|.|:.|..:..:...|       ....|..|..
plant   276 GT--HADDLPEKHMEALTHGVLATNRPFLWIVREKNPEEKKKNRFLELIRGSDRGLVVGWCSQTA 338

  Fly   355 LLCHPKIRAFISHGGLLGTTEAIHCGVPMLVTPFYGDQFLNSGAVKQR-GFGVIV---DFRDFDS 415
            :|.|..:..|::|.|...|.|::..|||::..|.:.||...:..|:.. ..||.|   :..|.|.
plant   339 VLAHCAVGCFVTHCGWNSTLESLESGVPVVAFPQFADQCTTAKLVEDTWRIGVKVKVGEEGDVDG 403

  Fly   416 NHITRGL-RIILDKKFAERVRRSSEAFR 442
            ..|.|.| :::...:.||.:|.::|.::
plant   404 EEIRRCLEKVMSGGEEAEEMRENAEKWK 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 76/353 (22%)
YjiC 38..461 CDD:224732 76/353 (22%)
AT4G14090NP_193146.1 YjiC 11..445 CDD:224732 76/353 (22%)
Glycosyltransferase_GTB_type 12..454 CDD:299143 76/353 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.