DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and AT3G55710

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_191130.1 Gene:AT3G55710 / 824737 AraportID:AT3G55710 Length:464 Species:Arabidopsis thaliana


Alignment Length:269 Identity:64/269 - (23%)
Similarity:104/269 - (38%) Gaps:85/269 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 FLPYTDEMSLIDRLNNFFHFHTVNTLYNMITQPATDALIAERFGPGLPP---------------- 234
            |..||....|||:            .|..|.....|.|:.|     |||                
plant   143 FCAYTAFPLLIDK------------GYLPIQGSRLDELVTE-----LPPLKVKDLPVIKTKEPEG 190

  Fly   235 ----INEIVKNTSL---MLIN-----QHYALTGPRPYAPNVIEVGGLQVGP-------IKPLPQH 280
                :|::|:...|   ::.|     :.::|...|    :.::|....:||       :.|.|::
plant   191 LNRILNDMVEGAKLSSGVVWNTFEDLERHSLMDCR----SKLQVPLFPIGPFHKHRTDLPPKPKN 251

  Fly   281 --------LLDLLDR-SPNGVIYISWGSMVNSNTLPSGKRSALFQSISQLKEYNFVMRW------ 330
                    |.|.|:: :|..|:|:|:||      |.:.:.:..|:....|:.......|      
plant   252 KDKDDDEILTDWLNKQAPQSVVYVSFGS------LAAIEENEFFEIAWGLRNSELPFLWVVRPGM 310

  Fly   331 ----KSLESLEDKQPSNL----YTFDWLPQRDLLCHPKIRAFISHGGLLGTTEAIHCGVPMLVTP 387
                :.||||......|:    ....|:.|.:.|.||.:.||.:|.|...|.|:|..||||:.||
plant   311 VRGTEWLESLPCGFLENIGHQGKIVKWVNQLETLAHPAVGAFWTHCGWNSTIESICEGVPMICTP 375

  Fly   388 FYGDQFLNS 396
            .:.||.:|:
plant   376 CFSDQHVNA 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 64/269 (24%)
YjiC 38..461 CDD:224732 64/269 (24%)
AT3G55710NP_191130.1 Glycosyltransferase_GTB_type 1..454 CDD:299143 64/269 (24%)
YjiC 7..421 CDD:224732 64/269 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.