DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and AT3G55700

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_191129.1 Gene:AT3G55700 / 824736 AraportID:AT3G55700 Length:460 Species:Arabidopsis thaliana


Alignment Length:211 Identity:52/211 - (24%)
Similarity:91/211 - (43%) Gaps:42/211 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 IEVGGLQVGPI-----KPLP----QHLLDLLDR-SPNGVIYISWGSMVNSN-----TLPSGKRSA 313
            ::|....:||.     .|.|    :...|.||: .|..|:|.|:||:....     .:..|.|::
plant   230 LQVPFFPIGPFHKYSEDPTPKTENKEDTDWLDKQDPQSVVYASFGSLAAIEEKEFLEIAWGLRNS 294

  Fly   314 LFQSISQLKEYNFVMR--------WKS------LESLEDKQPSNLYTFDWLPQRDLLCHPKIRAF 364
                   .:.:.:|:|        |..      :|::.||..    ...|..|.::|.||.|.||
plant   295 -------ERPFLWVVRPGSVRGTEWLESLPLGFMENIGDKGK----IVKWANQLEVLAHPAIGAF 348

  Fly   365 ISHGGLLGTTEAIHCGVPMLVTPFYGDQFLNSG-AVKQRGFGVIVDFRDFDSNHITRGLRIILDK 428
            .:|.|...|.|:|..||||:.|..:.||.:|:. .|.....|::::....:...|.:.||.::.:
plant   349 WTHCGWNSTLESICEGVPMICTSCFTDQHVNARYIVDVWRVGMLLERSKMEKKEIEKVLRSVMME 413

  Fly   429 KFAERVRRSSEAFRQR 444
            | .:.:|..|...::|
plant   414 K-GDGLRERSLKLKER 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 52/211 (25%)
YjiC 38..461 CDD:224732 52/211 (25%)
AT3G55700NP_191129.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 52/211 (25%)
YjiC 8..427 CDD:224732 51/208 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.