DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and UGT73C7

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_190884.1 Gene:UGT73C7 / 824482 AraportID:AT3G53160 Length:490 Species:Arabidopsis thaliana


Alignment Length:143 Identity:42/143 - (29%)
Similarity:57/143 - (39%) Gaps:36/143 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 LDLLDRSPNG-VIYISWGSMVNSNTLPSGKRSALFQSISQLKE---------------------Y 324
            |..||....| |:|:..||:.|   ||          ::||||                     |
plant   273 LQWLDSQETGSVLYVCLGSLCN---LP----------LAQLKELGLGLEASNKPFIWVIREWGKY 324

  Fly   325 NFVMRWKSLESLEDK-QPSNLYTFDWLPQRDLLCHPKIRAFISHGGLLGTTEAIHCGVPMLVTPF 388
            ..:..|......|:: :...|....|.||..:|.|..|..|::|.|...|.|.|..|||:|..|.
plant   325 GDLANWMQQSGFEERIKDRGLVIKGWAPQVFILSHASIGGFLTHCGWNSTLEGITAGVPLLTWPL 389

  Fly   389 YGDQFLNSGAVKQ 401
            :.:||||...|.|
plant   390 FAEQFLNEKLVVQ 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 42/143 (29%)
YjiC 38..461 CDD:224732 42/143 (29%)
UGT73C7NP_190884.1 Glycosyltransferase_GTB_type 7..489 CDD:299143 42/143 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.