DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and UGT72E1

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_566938.1 Gene:UGT72E1 / 824238 AraportID:AT3G50740 Length:487 Species:Arabidopsis thaliana


Alignment Length:452 Identity:97/452 - (21%)
Similarity:165/452 - (36%) Gaps:146/452 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 IVDLSNFESEWKPLGLPFKVPTYFMLHDWGLRSCKVALNSPLITQLLKSPIRYDVILLEHFSNDC 145
            ||||  |..:..|||..|.:.||..:.. ..|...|||..|.:.:.::.                
plant   114 IVDL--FGLDAIPLGGEFNMLTYIFIAS-NARFLAVALFFPTLDKDMEE---------------- 159

  Fly   146 MAAVAHLLNAPVIALSSCAIMPWHYKRMGSPFINPIMPM--NFLPYTDEMSLIDRLNNFFHFHTV 208
                .|::....:.:..|.  |..::.....|::|...:  .|:|:.......|.:       .|
plant   160 ----EHIIKKQPMVMPGCE--PVRFEDTLETFLDPNSQLYREFVPFGSVFPTCDGI-------IV 211

  Fly   209 NTLYNMITQPATDALIAERFGPGLPPINEIVKNTSLMLINQHYALTGPRPYAPNVIEVGGLQVGP 273
            ||..:|  :|.|                  :|:.      |...|.|         .:.|:.|.|
plant   212 NTWDDM--EPKT------------------LKSL------QDPKLLG---------RIAGVPVYP 241

  Fly   274 IKPLPQ--------H-LLDLLDRSPN-GVIYISWGSMVNSNTLPSGKRSALFQSISQL------- 321
            |.||.:        | :||.|::.|: .|:|||:||        .|..||  :.:::|       
plant   242 IGPLSRPVDPSKTNHPVLDWLNKQPDESVLYISFGS--------GGSLSA--KQLTELAWGLEMS 296

  Fly   322 -KEYNFVMR----------WKSLES--LEDKQPSNL-------------YTFDWLPQRDLLCHPK 360
             :.:.:|:|          :.|..|  :.|..|..|             ....|.||.::|.|..
plant   297 QQRFVWVVRPPVDGSACSAYLSANSGKIRDGTPDYLPEGFVSRTHERGFMVSSWAPQAEILAHQA 361

  Fly   361 IRAFISHGGLLGTTEAIHCGVPMLVTPFYGDQFLNSGAVKQRGFGVIVDFRDFDSNH-ITRG--- 421
            :..|::|.|.....|::..||||:..|.:.:|.:|:..:.:. .||.|..:...|.. |||.   
plant   362 VGGFLTHCGWNSILESVVGGVPMIAWPLFAEQMMNATLLNEE-LGVAVRSKKLPSEGVITRAEIE 425

  Fly   422 ---LRIILDKKFAERVRRSSEAFRQRPIPPIKLATWWIEHVIKYGGAPH-----IQSEARHI 475
               .:|:::::.||..::..           ||.....|.:...||..|     |..|:.|:
plant   426 ALVRKIMVEEEGAEMRKKIK-----------KLKETAAESLSCDGGVAHESLSRIADESEHL 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 97/452 (21%)
YjiC 38..461 CDD:224732 91/431 (21%)
UGT72E1NP_566938.1 PLN02992 1..487 CDD:178572 97/452 (21%)
YjiC 5..479 CDD:224732 97/452 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.