DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and AT3G46690

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_190253.1 Gene:AT3G46690 / 823822 AraportID:AT3G46690 Length:452 Species:Arabidopsis thaliana


Alignment Length:323 Identity:76/323 - (23%)
Similarity:121/323 - (37%) Gaps:118/323 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 FGPGLPPI----NEIV--KNTSLMLINQHYALTG------PRPYAPNVIEVGGLQVGPIKPLPQH 280
            ||| |.|:    .|:|  :..|.::||....|..      .:.....|..:|.|.:....|.|..
plant   185 FGP-LEPLLEMCREVVNKRTASAVIINTASCLESLSLSWLQQELGIPVYPLGPLHITASSPGPSL 248

  Fly   281 LLD-------LLDRSPNGVIYIS----------------WGSMVNSNTLPSGKRSALFQSISQLK 322
            |.:       |..:.|..|||||                || ::|||                 :
plant   249 LQEDMSCIEWLNKQKPRSVIYISLGTKAHMETKEMLEMAWG-LLNSN-----------------Q 295

  Fly   323 EYNFVMRWKSLESLE--DKQPSNL--------YTFDWLPQRDLLCHPKIRAFISHGGLLGTTEAI 377
            .:.:|:|..|:...|  :..|..:        |...|.||.::|.||.:..|.||.|...|.|:|
plant   296 PFLWVIRPGSVAGFEWIELLPEEVIKMVTERGYIAKWAPQIEVLGHPAVGGFWSHCGWNSTLESI 360

  Fly   378 HCGVPMLVTPFYGDQFLNS--------------GAVKQRGFGVIVDFRDFDSNHITRGL-RIILD 427
            ..||||:..|..|:|.||:              |.|::.|              :.|.: |:|:|
plant   361 VEGVPMICRPLQGEQKLNAMYIESVWKIGIQLEGEVEREG--------------VERAVKRLIID 411

  Fly   428 KKFAERVRRSSEAFRQRPIPPIKLATWWIEHVIKYGGAPHIQSEARHINWIVYNSIDVLLFWL 490
            ::.|        |.|:|.: .:|..   :...::.||:.             ||::|.|:.:|
plant   412 EEGA--------AMRERAL-DLKEK---LNASVRSGGSS-------------YNALDELVKFL 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 74/318 (23%)
YjiC 38..461 CDD:224732 69/292 (24%)
AT3G46690NP_190253.1 Glycosyltransferase_GTB_type 1..451 CDD:299143 76/323 (24%)
YjiC 7..431 CDD:224732 69/290 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.