DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and AT3G22250

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_188864.1 Gene:AT3G22250 / 821795 AraportID:AT3G22250 Length:461 Species:Arabidopsis thaliana


Alignment Length:176 Identity:45/176 - (25%)
Similarity:76/176 - (43%) Gaps:40/176 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 LLDRSPNGVIYISWGSMVNSNTLPSGKRSALFQSISQLKEYN---FVMRWKSLESLEDKQPSNLY 345
            |.:::||.|||||:||.|:    |.|:.:  .|:::...|.:   |:  |......::..|....
plant   277 LQEQNPNSVIYISFGSWVS----PIGESN--IQTLALALEASGRPFL--WALNRVWQEGLPPGFV 333

  Fly   346 -----------TFDWLPQRDLLCHPKIRAFISHGGLLGTTEAIHCGVPMLVTPFYGDQFLNSG-- 397
                       ...|.||.::|.:..:..:::|.|...|.||:.....:|..|..||||:|..  
plant   334 HRVTITKNQGRIVSWAPQLEVLRNDSVGCYVTHCGWNSTMEAVASSRRLLCYPVAGDQFVNCKYI 398

  Fly   398 ------AVKQRGFGVIVDFRDFDSNHITRGLRIIL-DKKFAERVRR 436
                  .|:..|||         ...:..|||.:: |:...||:|:
plant   399 VDVWKIGVRLSGFG---------EKEVEDGLRKVMEDQDMGERLRK 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 45/176 (26%)
YjiC 38..461 CDD:224732 45/176 (26%)
AT3G22250NP_188864.1 PLN02562 1..461 CDD:215305 45/176 (26%)
YjiC 6..445 CDD:224732 45/176 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48043
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.