DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and UGT71B1

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_188812.1 Gene:UGT71B1 / 821729 AraportID:AT3G21750 Length:473 Species:Arabidopsis thaliana


Alignment Length:476 Identity:98/476 - (20%)
Similarity:159/476 - (33%) Gaps:174/476 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RPMFLALAERGHNISMYSYFPLEKP------------VANYTDYVFQGMPL------LTDIVDLS 85
            |..::.|..|.....:.||...:||            |:..:|....|:.:      :.||.|..
plant    59 RLRYILLPARDQTTDLVSYIDSQKPQVRAVVSKVAGDVSTRSDSRLAGIVVDMFCTSMIDIADEF 123

  Fly    86 N------FESEWKPLGLPFKVPTYFMLHDWGLRSCKVALNSPLITQLLKSPIRYDV-ILLEHFSN 143
            |      :.|....|||.|.|.:   |:|      :..|:   :::...:.:::|| .|.:.|..
plant   124 NLSAYIFYTSNASYLGLQFHVQS---LYD------EKELD---VSEFKDTEMKFDVPTLTQPFPA 176

  Fly   144 DCMAAVAHLLNAPVIALSSCAIMPWHYKRMGSPFINPIMPMNFLPYTDEMSLIDRLNNFFHFHTV 208
            .|:.:|  :||                             ..:.||     ::.|..:|  ..|.
plant   177 KCLPSV--MLN-----------------------------KKWFPY-----VLGRARSF--RATK 203

  Fly   209 NTLYNMITQPATDALIAERFGPGLPPINEIVKNTSLMLINQHYALTGPRPYAPNVIEVGGLQVGP 273
            ..|.|.:......||.....|.|         ||::           |..||          |||
plant   204 GILVNSVADMEPQALSFFSGGNG---------NTNI-----------PPVYA----------VGP 238

  Fly   274 IKPLP--------QHLLDLLDRSP-NGVIYISWGSM----------------------------- 300
            |..|.        :.:|..|...| ..|:::.:|||                             
plant   239 IMDLESSGDEEKRKEILHWLKEQPTKSVVFLCFGSMGGFSEEQAREIAVALERSGHRFLWSLRRA 303

  Fly   301 ---VNSNTLPSGKRSALFQSISQLKEYNFVMRWKSLESLEDKQPSNLYTFDWLPQRDLLCHPKIR 362
               .|.:..|.|:    |.::.::....|:.|...:..:          ..|.||.|:|..|.|.
plant   304 SPVGNKSNPPPGE----FTNLEEILPKGFLDRTVEIGKI----------ISWAPQVDVLNSPAIG 354

  Fly   363 AFISHGGLLGTTEAIHCGVPMLVTPFYGDQFLNS-GAVKQRGFGVIVD---FRDF--------DS 415
            ||::|.|.....|::..||||...|.|.:|..|: ..|.:.|....|.   .|||        .:
plant   355 AFVTHCGWNSILESLWFGVPMAAWPIYAEQQFNAFHMVDELGLAAEVKKEYRRDFLVEEPEIVTA 419

  Fly   416 NHITRGLRIIL--DKKFAERV 434
            :.|.||::..:  |.|..:||
plant   420 DEIERGIKCAMEQDSKMRKRV 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 98/476 (21%)
YjiC 38..461 CDD:224732 98/476 (21%)
UGT71B1NP_188812.1 Glycosyltransferase_GTB_type 1..473 CDD:299143 98/476 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.