DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and AT3G02100

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_186859.1 Gene:AT3G02100 / 820287 AraportID:AT3G02100 Length:464 Species:Arabidopsis thaliana


Alignment Length:304 Identity:77/304 - (25%)
Similarity:119/304 - (39%) Gaps:80/304 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 RFGPGLPPI--------------------------NEIVKNTSLMLINQ-HYALTGPRPYAPNVI 264
            :..||:|.:                          |..:::|..:|.|. |...|......||::
plant   184 QLSPGMPKMETDKFVWVCLKNKESQKNIFQLMLQNNNSIESTDWLLCNSVHELETAAFGLGPNIV 248

  Fly   265 -----------EVGGLQVGPIKPLPQHLLDLLDRS-PNGVIYISWGSM-VNSNTLPSGKRSALFQ 316
                       |.|...:|...|..:..||.|||. |..|||:::||. |..|  |..:..|:..
plant   249 PIGPIGWAHSLEEGSTSLGSFLPHDRDCLDWLDRQIPGSVIYVAFGSFGVMGN--PQLEELAIGL 311

  Fly   317 SISQLKEYNFVMRWKSLESLEDKQPSNL-----YTFDWLPQRDLLCHPKIRAFISHGGLLGTTEA 376
            .:::..     :.|.:    .|:||..|     ....|.|||::|....|..|:||.|...|.|.
plant   312 ELTKRP-----VLWVT----GDQQPIKLGSDRVKVVRWAPQREVLSSGAIGCFVSHCGWNSTLEG 367

  Fly   377 IHCGVPMLVTPFYGDQFLNSG---AVKQRGFGVIVDFRDFDSNHITRGL--RIILDKKFAERVRR 436
            ...|:|.|..|::.|||:|..   .|.:.|.|:..|         .||:  |:.:.||..|.:|.
plant   368 AQNGIPFLCIPYFADQFINKAYICDVWKIGLGLERD---------ARGVVPRLEVKKKIDEIMRD 423

  Fly   437 SSEAFRQRPIPPIKLATWWIEHVIKYGGAPHIQSE--ARHINWI 478
            ..| :.:|.: .:|      |.|:|......|..|  .:.:|||
plant   424 GGE-YEERAM-KVK------EIVMKSVAKDGISCENLNKFVNWI 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 77/304 (25%)
YjiC 38..461 CDD:224732 71/283 (25%)
AT3G02100NP_186859.1 Glycosyltransferase_GTB_type 7..444 CDD:299143 72/287 (25%)
YjiC 11..437 CDD:224732 69/280 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48043
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.