DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and AT2G18570

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_849978.2 Gene:AT2G18570 / 816372 AraportID:AT2G18570 Length:470 Species:Arabidopsis thaliana


Alignment Length:353 Identity:77/353 - (21%)
Similarity:130/353 - (36%) Gaps:110/353 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 IMPMNFLPYTDEMSLIDRLNNFFHFHTVNT----LYNMITQPATDALIAERFG--------PGLP 233
            :|.::||. |:.||:.|.:.....:..|.|    |..|:..|..|.::...:.        ||..
plant   110 VMIVDFLG-TELMSVADDVGMTAKYVYVPTHAWFLAVMVYLPVLDTVVEGEYVDIKEPLKIPGCK 173

  Fly   234 PI--NEIVKNTSL----------------------MLINQHYALTGPRPYA-------PNVIEVG 267
            |:  .|::: |.|                      :|:|....|.|....|       ..|::|.
plant   174 PVGPKELME-TMLDRSGQQYKECVRAGLEVPMSDGVLVNTWEELQGNTLAALREDEELSRVMKVP 237

  Fly   268 GLQVGPIKPLPQH------LLDLLD-RSPNGVIYISWGSMVNSNTLPSGKRSALFQSISQL---- 321
            ...:|||....||      :.:.|| :....|:::..||   ..||       .|:...:|    
plant   238 VYPIGPIVRTNQHVDKPNSIFEWLDEQRERSVVFVCLGS---GGTL-------TFEQTVELALGL 292

  Fly   322 ----KEYNFVMR----WKSLESLEDKQPS--------------NLYTFDWLPQRDLLCHPKIRAF 364
                :.:.:|:|    :....|.:|:|.|              .:....|.||.::|.|..|..|
plant   293 ELSGQRFVWVLRRPASYLGAISSDDEQVSASLPEGFLDRTRGVGIVVTQWAPQVEILSHRSIGGF 357

  Fly   365 ISHGGLLGTTEAIHCGVPMLVTPFYGDQFLNSGAVKQRGFGVIVDFRDFDSNHI----------- 418
            :||.|.....|::..|||::..|.|.:|::|:..:.:. .||.|...:..|..:           
plant   358 LSHCGWSSALESLTKGVPIIAWPLYAEQWMNATLLTEE-IGVAVRTSELPSERVIGREEVASLVR 421

  Fly   419 -------TRGLRIILDKKFAERVRRSSE 439
                   ..|.:|   :..||.||.|||
plant   422 KIMAEEDEEGQKI---RAKAEEVRVSSE 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 77/353 (22%)
YjiC 38..461 CDD:224732 77/353 (22%)
AT2G18570NP_849978.2 PLN03015 1..470 CDD:178589 77/353 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.