Sequence 1: | NP_609909.1 | Gene: | Ugt36F1 / 35137 | FlyBaseID: | FBgn0027074 | Length: | 525 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_179446.2 | Gene: | AT2G18560 / 816371 | AraportID: | AT2G18560 | Length: | 380 | Species: | Arabidopsis thaliana |
Alignment Length: | 387 | Identity: | 80/387 - (20%) |
---|---|---|---|
Similarity: | 129/387 - (33%) | Gaps: | 153/387 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 207 TVNTLYNMITQPATDALIAERFGPGLPPINEIVKNTSLMLINQH---YALTGPRPYAPNVIEVGG 268
Fly 269 --------LQVGPIKPL-PQHLLD-LLDRS----------------PNGVIYISWGSM------- 300
Fly 301 ---------------------VNSNTLPSGKRSALFQSISQLKEYNFV----------------- 327
Fly 328 MRWKSLE--------------------SLEDKQPSN--------------LYTFDWLPQRDLLCH 358
Fly 359 PKIRAFISHGGLLGTTEAIHCGVPMLVTPFYGDQFLNSGAVKQRGFGVIVDFRDFDSNHI----- 418
Fly 419 -------------TRGLRIILDKKFAERVRRSSEAFRQRPIPPIKLATWWIEHVIKYGGAPH 467 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ugt36F1 | NP_609909.1 | egt | 19..487 | CDD:223071 | 80/387 (21%) |
YjiC | 38..461 | CDD:224732 | 77/379 (20%) | ||
AT2G18560 | NP_179446.2 | Glycosyltransferase_GTB_type | 1..380 | CDD:299143 | 80/387 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X13 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |