DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and UGT2A3

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_011530549.1 Gene:UGT2A3 / 79799 HGNCID:28528 Length:533 Species:Homo sapiens


Alignment Length:529 Identity:144/529 - (27%)
Similarity:236/529 - (44%) Gaps:107/529 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SHFDFFRPMFLALAERGHNISMYS--------------------YFPLEKPVAN--YTDYVFQGM 75
            ||:...:.:...|..|||.:::.:                    :.|.::...|  :.|.....:
Human    34 SHWLNVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEENEIFVDLALNVL 98

  Fly    76 PLLTDIVDLSNFESEWKPLGLPFKVPTYFMLHDWGLR-SCKVALNSPLITQLLKSPIR---YDVI 136
            |.|          |.|:.:   .|:..:|:    .:| :.|:...|.:..|.|...::   |||:
Human    99 PGL----------STWQSV---IKLNDFFV----EIRGTLKMMCESFIYNQTLMKKLQETNYDVM 146

  Fly   137 LLEHFSNDCMAAVAHLLNAP-VIAL---------SSCAIMPWHYKRMGSPFINPIMPMNFLP--- 188
            |::... .|...:|.||..| |:.|         .||..:|              .|::::|   
Human   147 LIDPVI-PCGDLMAELLAVPFVLTLRISVGGNMERSCGKLP--------------APLSYVPVPM 196

  Fly   189 --YTDEMSLIDRLNN-----FFHFHTVNTLYNMITQPATDALIAERFGPGLP-PINEIVKNTSLM 245
              .||.|:.::|:.|     .|||...:..|:...:..:.||       |.| .:.|.|....:.
Human   197 TGLTDRMTFLERVKNSMLSVLFHFWIQDYDYHFWEEFYSKAL-------GRPTTLCETVGKAEIW 254

  Fly   246 LINQHYALTGPRPYAPNVIEVGGLQVGPIKPLP------QHLLDLLDRS-PNGVIYISWGSMVNS 303
            ||..::....|:||.||...||||...|.|.||      |.:.:.:..| .:|::..|.||:..:
Human   255 LIRTYWDFEFPQPYQPNFEFVGGLHCKPAKALPKINFYLQEMENFVQSSGEDGIVVFSLGSLFQN 319

  Fly   304 NTLPSGKRSALFQSISQLKEYNFVMRWKSLESLEDKQPS----NLYTFDWLPQRDLLCHPKIRAF 364
            .|  ..|.:.:..:::|:.:       |.|...:.|:||    |...:||:||.|||.|||.:||
Human   320 VT--EEKANIIASALAQIPQ-------KVLWRYKGKKPSTLGANTRLYDWIPQNDLLGHPKTKAF 375

  Fly   365 ISHGGLLGTTEAIHCGVPMLVTPFYGDQFLNSGAVKQRGFGVIVDFRDFDSNHITRGLR-IILDK 428
            |:|||:.|..|||:.||||:..|.:|||..|...:|.:|..|.::|:...|..:.|.|| :|.|.
Human   376 ITHGGMNGIYEAIYHGVPMVGVPIFGDQLDNIAHMKAKGAAVEINFKTMTSEDLLRALRTVITDS 440

  Fly   429 KFAERVRRSSEAFRQRPIPPIKLATWWIEHVIKYGGAPHIQSEARHINWIVYNSIDVLLFWLGIL 493
            .:.|...|.|.....:|:.|:..|.:|||.|:::.||.|::|.|..:.|..:.||||:.|.|..:
Human   441 SYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRSAAHDLTWFQHYSIDVIGFLLACV 505

  Fly   494 FLLIVALRK 502
            ...|....|
Human   506 ATAIFLFTK 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 140/512 (27%)
YjiC 38..461 CDD:224732 128/481 (27%)
UGT2A3XP_011530549.1 UDPGT 24..528 CDD:278624 144/529 (27%)
egt <267..498 CDD:223071 85/239 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.