DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and arhgap17

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_002932512.1 Gene:arhgap17 / 549590 XenbaseID:XB-GENE-981776 Length:856 Species:Xenopus tropicalis


Alignment Length:252 Identity:50/252 - (19%)
Similarity:85/252 - (33%) Gaps:98/252 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 PYAPNVIEVGGLQVGPIKPLPQHLLDLLDRSPNGVIYISW---GSMVNSNTLPSGKRSALFQSIS 319
            |:|     |.|.....::.||:.|:..       .:|..|   |::.:.||    |..||:....
 Frog   317 PHA-----VAGALKSYLRELPEPLMTF-------NLYEEWNHAGNIPDQNT----KLQALWVVCQ 365

  Fly   320 QLKEYN---------FVMRWKSLESLEDKQPSNLYTFDWLPQRDLLCHPKIRAFISHGGLLGTTE 375
            :|.:.|         |:.:......:....|||:         .::..|.: .:..|.|.|....
 Frog   366 KLPKPNLENFRYLVKFLAKLSHHSDINKMTPSNI---------AIVLGPNL-LWARHEGTLAEIA 420

  Fly   376 A---IHCGVPMLVTP-------FYGDQ--FLNSGAV---------------------------KQ 401
            |   :|  |..::.|       |:.|:  |..|||.                           |:
 Frog   421 AATSVH--VMTIIEPIIQHADWFFPDELDFNVSGAFVPVAPTTHSNNVPYTGNDMSYEFGPLEKK 483

  Fly   402 RGFGVIVD---FRDFDSNHITRGLRIILDKKFAERVRRSSEAFR-------QRPIPP 448
            |.|.:::|   .||      :.||:::   .:....||.....|       |.|:||
 Frog   484 RPFSMVMDGELKRD------SSGLKVM---DYYLNTRRGGTLNRKHGAPTVQPPLPP 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 50/252 (20%)
YjiC 38..461 CDD:224732 50/252 (20%)
arhgap17XP_002932512.1 BAR 13..257 CDD:386243
RhoGAP_nadrin 246..445 CDD:239851 30/155 (19%)
DUF5585 515..>849 CDD:375359 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165169294
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.