Sequence 1: | NP_609909.1 | Gene: | Ugt36F1 / 35137 | FlyBaseID: | FBgn0027074 | Length: | 525 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002932512.1 | Gene: | arhgap17 / 549590 | XenbaseID: | XB-GENE-981776 | Length: | 856 | Species: | Xenopus tropicalis |
Alignment Length: | 252 | Identity: | 50/252 - (19%) |
---|---|---|---|
Similarity: | 85/252 - (33%) | Gaps: | 98/252 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 258 PYAPNVIEVGGLQVGPIKPLPQHLLDLLDRSPNGVIYISW---GSMVNSNTLPSGKRSALFQSIS 319
Fly 320 QLKEYN---------FVMRWKSLESLEDKQPSNLYTFDWLPQRDLLCHPKIRAFISHGGLLGTTE 375
Fly 376 A---IHCGVPMLVTP-------FYGDQ--FLNSGAV---------------------------KQ 401
Fly 402 RGFGVIVD---FRDFDSNHITRGLRIILDKKFAERVRRSSEAFR-------QRPIPP 448 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ugt36F1 | NP_609909.1 | egt | 19..487 | CDD:223071 | 50/252 (20%) |
YjiC | 38..461 | CDD:224732 | 50/252 (20%) | ||
arhgap17 | XP_002932512.1 | BAR | 13..257 | CDD:386243 | |
RhoGAP_nadrin | 246..445 | CDD:239851 | 30/155 (19%) | ||
DUF5585 | 515..>849 | CDD:375359 | 5/17 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165169294 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |