DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and T19H12.12

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001024147.2 Gene:T19H12.12 / 3565072 WormBaseID:WBGene00044282 Length:153 Species:Caenorhabditis elegans


Alignment Length:119 Identity:18/119 - (15%)
Similarity:43/119 - (36%) Gaps:28/119 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 FLPYTDEMSLIDRLNNFFHFHTVNTLYNMITQPATDALIAERFGPGLPPINEIVKNTSLMLINQH 250
            |..::.::.:.:.:..|.|...::.:.::|........:.:.:...|..::.:|||.::.::|.|
 Worm    14 FKCHSSKILIFNPIYGFSHVKFISKVADIIADHGHHVTLFQPYHIALKNLDGLVKNKNIEILNYH 78

  Fly   251 YALTGPRPYAPNVIEVGGLQVGPIKPLPQHLLDLLDRSPNGVIYISWGSMVNSN 304
                                       |.|..:||...|....:. |.|.:..|
 Worm    79 ---------------------------PTHYEELLKAEPQAFSFF-WDSHLVGN 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 18/119 (15%)
YjiC 38..461 CDD:224732 18/119 (15%)
T19H12.12NP_001024147.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161496
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.