DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and Ugt3a2

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_038959826.1 Gene:Ugt3a2 / 294793 RGDID:1564365 Length:454 Species:Rattus norvegicus


Alignment Length:440 Identity:115/440 - (26%)
Similarity:196/440 - (44%) Gaps:49/440 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LPFKVPTYFMLHDWGLRSCKVALNSPLITQLLKSPIRYDVILLEHFSND-CMAAVAHLLNAPVIA 159
            |.|:..|...:|......|...|:...|.:.||: ..:|::|.|  |.| |.:.:...|....:.
  Rat    33 LQFEHHTIVKIHRHFGDLCNHLLSRKDIMEFLKN-ANFDLVLFE--SVDYCSSLIVEKLGKQFVL 94

  Fly   160 LSS--CAIMPWHYKRMGSPFINPIMPMNFLP-----YTDEMSLIDRLNNFFHFHTVNTLYNMITQ 217
            ..:  ...|.:..:|         :|::::|     .||:|....|:.||..|..::.....|..
  Rat    95 FLAFQLGFMDFELQR---------VPLSYVPVYGSGLTDQMDFWGRVKNFLMFFDLSRKQREILS 150

  Fly   218 PATDALIAERFGPGLPPI-NEIVKNTSLMLINQHYALTGPRPYAPNVIEVGGLQVGPIKPLPQHL 281
             ..|:.|.|.|..|..|: ::::....|..:|..:|....||..||::.||||...|::.:||.|
  Rat   151 -QYDSTIQEHFAEGSRPVLSDLLLKAELWFVNCDFAFEFARPLFPNIVYVGGLLDKPVQSIPQDL 214

  Fly   282 LDLLDR-SPNGVIYISWGSMVNSNTLPSGKRSALFQSISQLKEYNFVMR-------WKSLESLED 338
            .:.:.: ..:|.:.::.|::...           ||:...:||.|....       |...:|...
  Rat   215 ENFITQFGDSGFVLVALGTVATK-----------FQTKEIIKEMNNAFAHLPQGVIWACKDSHWP 268

  Fly   339 KQPS---NLYTFDWLPQRDLLCHPKIRAFISHGGLLGTTEAIHCGVPMLVTPFYGDQFLNSGAVK 400
            |..:   |:...|||||.|||.||.||.|::|||:....|||..||||:...|:.||..|...|:
  Rat   269 KDVTLAPNVKIMDWLPQTDLLAHPSIRLFVTHGGMNSVNEAIQHGVPMVGILFFSDQPENMIRVE 333

  Fly   401 QRGFGVIVDFRDFDSNHITRGLR-IILDKKFAERVRRSSEAFRQRPIPPIKLATWWIEHVIKYGG 464
            .:..||.:..:...:....|.:: :|.||::......|.......|:.|.:....||:|:::.||
  Rat   334 AKTIGVSIQIQTLKAETFARTMKEVIEDKRYKSAAMASKIIRHSHPLTPSQRLEGWIDHILQTGG 398

  Fly   465 APHIQSEARHINWIVYNSIDVLLFWLGI----LFLLIVALRKLIKIFKTA 510
            |.|::..|....|.....:||.||.||:    ::|.:..|..:::....|
  Rat   399 AAHLKPYAFQQPWHEQYLLDVFLFLLGLTLGTVWLCVKVLGAVMRYLSGA 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 108/411 (26%)
YjiC 38..461 CDD:224732 100/385 (26%)
Ugt3a2XP_038959826.1 Glycosyltransferase_GTB-type 49..419 CDD:415824 102/393 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344004
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.