DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and Y43D4A.2

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_502984.3 Gene:Y43D4A.2 / 189851 WormBaseID:WBGene00012788 Length:151 Species:Caenorhabditis elegans


Alignment Length:125 Identity:28/125 - (22%)
Similarity:54/125 - (43%) Gaps:15/125 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 CKVALNSPLITQLLKSPIRYDVILLEHF---SNDCMAAV---AHLLNAPVIALSSCAIMPWHYKR 172
            |:..|....:.:.|::. .:|:.:.|.|   :|....|:   ||      :|:.||:.:....|.
 Worm    23 CRKVLEDKELIERLRAE-NFDLAITEPFDTCANALFEAIKIRAH------VAVLSCSRLDHVSKA 80

  Fly   173 MGSPFINPIMPMNFLPYTDEMSLIDRLNNFFHFHTVNTLYNMITQPATDALIAERFGPGL 232
            :|.|.....:|.....:.:.|::..|..|..||...:.|::.|..  .|..:|:...||:
 Worm    81 IGQPIAPSYLPGTQSTHGERMTIWQRFMNILHFLMGDFLFSYIGD--EDFKVAKEIIPGV 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 28/125 (22%)
YjiC 38..461 CDD:224732 28/125 (22%)
Y43D4A.2NP_502984.3 UDPGT 14..>120 CDD:278624 22/103 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161380
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.