DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and UGT3A2

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_011512290.1 Gene:UGT3A2 / 167127 HGNCID:27266 Length:550 Species:Homo sapiens


Alignment Length:562 Identity:156/562 - (27%)
Similarity:234/562 - (41%) Gaps:121/562 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LALLAFLLRPKP----NDAAHILGLFQHPGKSHFDFFRPMFLALAERGHNISMYSYFPLEKPVAN 66
            |.|:.|||   |    ::||.||.: ...|.||:.....:...|.:.|||::|          .|
Human     7 LLLVGFLL---PGVLLSEAAKILTI-STVGGSHYLLMDRVSQILQDHGHNVTM----------LN 57

  Fly    67 YTDYVFQGMPLLTDI------------------VDLSNFESEWKPLGL-----------PFKVPT 102
            :....|  ||.|:|.                  ..|.:|:.|.|...:           .||...
Human    58 HKRGPF--MPGLSDSPASASRYPRILYLQKYCQFGLKDFKKEEKSYQVISWLAPEDHQREFKKSF 120

  Fly   103 YFMLHD-WGLR---------------SCKVALNSPLITQLLKSPIRYDVILLEHFSNDCMAAVAH 151
            .|.|.: .|.|               .|...||...|...||:. .:|::::|.| :.|...:|.
Human   121 DFFLEETLGGRGKFENLLNVLEYLALQCSHFLNRKDIMDSLKNE-NFDMVIVETF-DYCPFLIAE 183

  Fly   152 LLNAPVIALSSCAIMPWHYKRMGSPFINPIMPMNFLP-----YTDEMSLIDRLNNFFHF------ 205
            .|..|.:|:.|.:.....:   |.|     :|::::|     .||.|....|:.||..|      
Human   184 KLGKPFVAILSTSFGSLEF---GLP-----IPLSYVPVFRSLLTDHMDFWGRVKNFLMFFSFCRR 240

  Fly   206 --HTVNTLYNMITQPATDALIAERFGPGLPPI-NEIVKNTSLMLINQHYALTGPRPYAPNVIEVG 267
              |..:|.         |..|.|.|..|..|: :.::....|..||..:|....||..||.:.||
Human   241 QQHMQSTF---------DNTIKEHFTEGSRPVLSHLLLKAELWFINSDFAFDFARPLLPNTVYVG 296

  Fly   268 GLQVGPIKPLPQHLLDLLDR-SPNGVIYISWGSMVNSNTLPSGKRSALFQSISQLKEYNFVMR-- 329
            ||...||||:||.|.:.:.: ..:|.:.::.|||||:...|.     :|      ||.|....  
Human   297 GLMEKPIKPVPQDLENFIAKFGDSGFVLVTLGSMVNTCQNPE-----IF------KEMNNAFAHL 350

  Fly   330 -----WKSLESLEDKQ---PSNLYTFDWLPQRDLLCHPKIRAFISHGGLLGTTEAIHCGVPMLVT 386
                 ||...|...|.   .:|:...|||||.|||.||.||.|::|||.....|||..||||:..
Human   351 PQGVIWKCQCSHWPKDVHLAANVKIVDWLPQSDLLAHPSIRLFVTHGGQNSIMEAIQHGVPMVGI 415

  Fly   387 PFYGDQFLNSGAVKQRGFGVIVDFRDFDSNHITRGLRIIL-DKKFAERVRRSSEAFRQRPIPPIK 450
            |.:|||..|...|:.:.|||.:..:...:..:...::.|: ||::......:|...|..|:.|.:
Human   416 PLFGDQPENMVRVEAKKFGVSIQLKKLKAETLALKMKQIMEDKRYKSAAVAASVILRSHPLSPTQ 480

  Fly   451 LATWWIEHVIKYGGAPHIQSEARHINWIVYNSIDVLLFWLGI 492
            ....||:||::.|||.|::.......|.....:||.:|.||:
Human   481 RLVGWIDHVLQTGGATHLKPYVFQQPWHEQYLLDVFVFLLGL 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 147/538 (27%)
YjiC 38..461 CDD:224732 133/493 (27%)
UGT3A2XP_011512290.1 UDPGT 23..518 CDD:278624 146/537 (27%)
egt <162..517 CDD:223071 114/384 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150150
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.