DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and AT1G05675

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001184915.1 Gene:AT1G05675 / 10723139 AraportID:AT1G05675 Length:453 Species:Arabidopsis thaliana


Alignment Length:247 Identity:62/247 - (25%)
Similarity:96/247 - (38%) Gaps:60/247 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 LQVGPIKP---LPQHLLD-------------------LLDRSPNGVIYISWGSMVNSNTLPSGKR 311
            |.:||..|   |.:.|.:                   |..:.|:.|:|:|:||:|..      |:
plant   227 LNIGPTVPSMYLDKRLAEDKNYGFSLFGAKIAECMEWLNSKQPSSVVYVSFGSLVVL------KK 285

  Fly   312 SALFQSISQLKEYNFVMRWKSLESLEDKQPSNL--------YTFDWLPQRDLLCHPKIRAFISHG 368
            ..|.:..:.||:......|...|:...|.|.|.        .|..|.||.::|.|..|..|::|.
plant   286 DQLIELAAGLKQSGHFFLWVVRETERRKLPENYIEEIGEKGLTVSWSPQLEVLTHKSIGCFVTHC 350

  Fly   369 GLLGTTEAIHCGVPMLVTPFYGDQFLNSGAVK---QRGFGVIVDFRDFDSNHITRGLRIILDKKF 430
            |...|.|.:..||||:..|.:.||..|:..::   :.|..|..|...|           :..::|
plant   351 GWNSTLEGLSLGVPMIGMPHWADQPTNAKFMEDVWKVGVRVKADSDGF-----------VRREEF 404

  Fly   431 AERVRRSSEAFRQRPIPPIKLATWW---IEHVIKYGGAPHIQSEARHINWIV 479
            ..||....||.:.:.|.  |.|..|   .:..:..||     |..::||..|
plant   405 VRRVEEVMEAEQGKEIR--KNAEKWKVLAQEAVSEGG-----SSDKNINEFV 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 62/247 (25%)
YjiC 38..461 CDD:224732 56/227 (25%)
AT1G05675NP_001184915.1 Glycosyltransferase_GTB-type 6..450 CDD:415824 62/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.