DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and LOC100493420

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_004919757.2 Gene:LOC100493420 / 100493420 -ID:- Length:742 Species:Xenopus tropicalis


Alignment Length:173 Identity:31/173 - (17%)
Similarity:52/173 - (30%) Gaps:68/173 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 SLIDRLNNFFHFHTVNTLYNMITQPATDALIAERFG------PGLPPINEIVKNTSLM------- 245
            |::..|:|...||::.. |.........|:.|.||.      |...|:::|:.:.:|:       
 Frog   565 SVMFHLSNKHSFHSLEN-YKKCQHKRIPAVKARRFAWITSEHPAYAPLSKIINDKALLRDISKIE 628

  Fly   246 -----------------LINQHYALTGPRPYAPNVI-----------EVGGLQVGPIKPLP---- 278
                             ..::..:|.....||..::           |...|......|||    
 Frog   629 KFCHTRDLESFRSNVLKYKSKRLSLNMDSMYADTILAALSQNRNVSREEAKLNCPQNSPLPFGEK 693

  Fly   279 -------------------QHLLDLLDRS---PNGVIYISWGS 299
                               .||||::..|   .||.:...|.|
 Frog   694 HYKVSFCKQNNRVEDDVVDDHLLDIMSNSLKILNGELVNQWSS 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 31/173 (18%)
YjiC 38..461 CDD:224732 31/173 (18%)
LOC100493420XP_004919757.2 THAP 5..94 CDD:398893
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165169293
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.