DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and XB5897453

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_002940579.4 Gene:XB5897453 / 100492852 XenbaseID:XB-GENE-5897454 Length:2984 Species:Xenopus tropicalis


Alignment Length:181 Identity:37/181 - (20%)
Similarity:63/181 - (34%) Gaps:52/181 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GLPFKVPTYF-MLHDWGLRSCKVALNSPLITQLLKSPIRYDVILLEHFSNDCMAAVAHLLNAPVI 158
            |.|..||.|. :...||....:.                ||....: |...|...:...:.    
 Frog  1634 GTPVCVPDYTGVCWAWGAPHYQT----------------YDNFNYQ-FEGTCTYVLTEYIG---- 1677

  Fly   159 ALSSCAIMPWHYKRM----GSPFINPIMPMNFLPYTDEMSLI----------DRLNNFFHFHTVN 209
              ....::|:..:..    |||.|:.|..::...|..::|:.          |.:.|     |..
 Frog  1678 --QDTTLVPFRIEEQKENRGSPIISFIRQIDVFVYGYKISVAKGEYGKVRVNDEIGN-----TPV 1735

  Fly   210 TLYN---MITQPATDALIAERFGPGLPPINEIVKNTSLM--LINQHYALTG 255
            ||.|   .:|...::|::...|  ||....:.  ||.:|  :.:.:||.||
 Frog  1736 TLLNGKISVTFSGSEAILNTDF--GLQVTYDY--NTKVMVSIPSSYYASTG 1782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 37/181 (20%)
YjiC 38..461 CDD:224732 37/181 (20%)
XB5897453XP_002940579.4 IgGFc_binding 123..408 CDD:407525
VWD 456..613 CDD:214566
C8 653..728 CDD:214843
TIL 732..785 CDD:410995
VWC 787..842 CDD:327433
VWD 849..1005 CDD:395046
C8 1045..1116 CDD:214843
TIL 1120..1173 CDD:410995
VWC 1175..1229 CDD:327433
VWD 1228..1384 CDD:214566
C8 1433..1502 CDD:214843
TIL 1505..1558 CDD:410995
VWC 1560..1612 CDD:327433
VWD 1646..1802 CDD:395046 32/169 (19%)
C8 1841..1917 CDD:214843
TIL 1920..1973 CDD:410995
VWC 1975..2030 CDD:327433
VWD 2037..2186 CDD:395046
C8 2229..2303 CDD:214843
TIL 2307..2360 CDD:410995
VWC 2362..2416 CDD:327433
VWD 2423..2579 CDD:395046
C8 2619..2693 CDD:214843
TIL 2696..2749 CDD:410995
VWC 2751..2804 CDD:327433
VWD 2807..2960 CDD:413350
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165169324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.