DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ham and ZNF30

DIOPT Version :9

Sequence 1:NP_724130.4 Gene:ham / 35135 FlyBaseID:FBgn0045852 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_001092907.1 Gene:ZNF30 / 90075 HGNCID:13090 Length:624 Species:Homo sapiens


Alignment Length:700 Identity:147/700 - (21%)
Similarity:232/700 - (33%) Gaps:251/700 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 RCEVCDKVYPDLDLLDDHLIGAH---HFKQDEFPCKQCALRFCHRPLLIKHEAISHNNIRKYSCE 401
            ||:.|.|     :..:.|.:..|   |..:..:..::|...|......:||..| |...:...|:
Human   150 RCKECGK-----NFSNGHQLTIHQRLHVGEKPYKYEKCGKAFISGSAFVKHGRI-HTGEKPLKCK 208

  Fly   402 NCSKVFCDPSNLQRHIRAYHVGARCHPCPECGKTFGTSSGLKQHQHIHSSVKPFACEVCSKAYTQ 466
            .|.|.......|..| ::.|.|.:.:.|.||||.|.....|.:||..|:..|||.||.|.||::.
Human   209 QCGKTISGSYQLTVH-KSIHTGKKPYECGECGKAFLVYGKLTRHQSTHTGEKPFGCEECGKAFST 272

  Fly   467 FSNLCRHKRMHATCRMQIKCDKCNQSFSTLTSLTKHKKFCDSTGPGPYRNQHVNRHHQHPHQHPL 531
            ||.|.:|:|:| |.....:|.:|.::|||.:.|.||::.  .||..||                 
Human   273 FSYLVQHQRIH-TSEKPYECKECGKAFSTSSPLAKHQRI--HTGEKPY----------------- 317

  Fly   532 PHQPHLAATATSTCPAPPRESSESSSSAAAAAVAAMSTPPNPFLMFRTAPSFFPGFPPYGFPPFL 596
                               |..|...|                            |..||     
Human   318 -------------------ECKECGKS----------------------------FTVYG----- 330

  Fly   597 PQNPLHPTNIPMFFSKNPMDLGCGGPEITSPVSAFDQKLPFGFLKGENSESQAYDKVTEKELVFK 661
                                      ::|...|....:.||        |.:...|.........
Human   331 --------------------------QLTRHQSIHTGEKPF--------ECKECGKAFRLSSFLH 361

  Fly   662 AEEKLKKEPLVQAFEGEE---DESRSSLDIK-GKLEDTRNDSKSEEQDDMKQEPERVSTPDQQQA 722
            |.:::..|  ::.:..:|   ..||:|..:: |:|..                            
Human   362 AHQRIHAE--IKPYGCKECGRTFSRASYLVQHGRLHT---------------------------- 396

  Fly   723 EDDRKSIDIMSTPPPADTPSGGDGPLDLSICRKR-SAGSFFTAPAEDNLMLHRFMPRLHEFEAER 786
                                 |:.|.:...|.|. |.||:        |:.|:   |:|..|   
Human   397 ---------------------GEKPYECKECGKAFSTGSY--------LVQHQ---RIHTGE--- 426

  Fly   787 GQPLKMRKSH----SSAESSTSQKSHKGSSPTPTPTASPG------LTPSPSPPTSAGGELSSTS 841
             :|.:.::..    |..:.:..|:.|.|..|.........      ||......|..  :.....
Human   427 -KPYECKECGKAFISRHQLTVHQRVHTGEKPYECKECGKAFRVHVHLTQHRKIHTDV--KPYECK 488

  Fly   842 EGGAVPTMAAAAFAADHSALASGPTLPQTHPTFHPLLLEEIYRSGFPFLCQPGGRRGIEALLAGA 906
            |.|  .|.:.|::...||.:.:|..                     |:.|:..|:          
Human   489 ECG--KTFSRASYLVQHSRIHTGKK---------------------PYECKECGK---------- 520

  Fly   907 ASAAAPKRPLPPVKFSAGSVV----GLKTKDR-YSCKFCGKVFPRSANLTRHLRTHTGEQPYPCK 966
                         .||:||.:    .:.|.:: |.|..|||.|.....|..|...||||:|:.||
Human   521 -------------AFSSGSYLVQHQRIHTGEKPYECNKCGKAFTVYGQLIGHQSVHTGEKPFECK 572

  Fly   967 YCDRAFSISSNLQRHVRNIHNKERPFRCELCDRSFGQQTNLDRHVKKHES 1016
            .|.:||.::|.|..|.| :|..|:||:|:.|.::|...:.|..|::||.|
Human   573 ECGKAFRLNSFLTEHQR-VHTGEKPFKCKKCGKTFRYSSALKVHLRKHMS 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hamNP_724130.4 PR-SET_ZFPM 131..253 CDD:380978
C2H2 Zn finger 341..363 CDD:275368 5/24 (21%)
C2H2 Zn finger 371..392 CDD:275368 5/20 (25%)
SFP1 <391..479 CDD:227516 32/87 (37%)
C2H2 Zn finger 400..421 CDD:275368 5/20 (25%)
SUF4-like 403..>445 CDD:411020 13/41 (32%)
C2H2 Zn finger 403..421 CDD:411020 4/17 (24%)
C2H2 Zn finger 429..449 CDD:275368 9/19 (47%)
C2H2 Zn finger 457..477 CDD:275368 10/19 (53%)
C2H2 Zn finger 486..504 CDD:275368 8/17 (47%)
PTZ00121 <641..>728 CDD:173412 10/90 (11%)
COG5048 935..>1028 CDD:227381 33/81 (41%)
zf-C2H2 935..957 CDD:395048 8/21 (38%)
C2H2 Zn finger 937..957 CDD:275368 7/19 (37%)
zf-H2C2_2 949..973 CDD:404364 11/23 (48%)
C2H2 Zn finger 965..986 CDD:275368 9/20 (45%)
C2H2 Zn finger 994..1014 CDD:275368 5/19 (26%)
ZNF30NP_001092907.1 KRAB 14..75 CDD:214630
KRAB 14..53 CDD:279668
COG5048 <97..302 CDD:227381 50/159 (31%)
C2H2 Zn finger 123..143 CDD:275368
C2H2 Zn finger 151..171 CDD:275368 5/24 (21%)
C2H2 Zn finger 179..199 CDD:275368 5/20 (25%)
C2H2 Zn finger 207..227 CDD:275368 5/20 (25%)
C2H2 Zn finger 235..255 CDD:275368 9/19 (47%)
COG5048 245..624 CDD:227381 120/597 (20%)
C2H2 Zn finger 263..283 CDD:275368 10/19 (53%)
zf-H2C2_2 275..300 CDD:290200 8/25 (32%)
C2H2 Zn finger 291..311 CDD:275368 8/21 (38%)
zf-H2C2_2 304..327 CDD:290200 10/88 (11%)
C2H2 Zn finger 319..339 CDD:275368 7/78 (9%)
zf-H2C2_2 332..354 CDD:290200 6/29 (21%)
C2H2 Zn finger 347..367 CDD:275368 2/19 (11%)
C2H2 Zn finger 375..395 CDD:275368 5/19 (26%)
C2H2 Zn finger 403..423 CDD:275368 8/30 (27%)
zf-H2C2_2 415..438 CDD:290200 6/37 (16%)
C2H2 Zn finger 431..451 CDD:275368 2/19 (11%)
zf-H2C2_2 444..466 CDD:290200 4/21 (19%)
C2H2 Zn finger 459..479 CDD:275368 2/19 (11%)
zf-H2C2_2 471..496 CDD:290200 6/28 (21%)
C2H2 Zn finger 487..507 CDD:275368 6/21 (29%)
zf-H2C2_2 499..524 CDD:290200 7/68 (10%)
C2H2 Zn finger 515..535 CDD:275368 6/42 (14%)
zf-H2C2_2 527..551 CDD:290200 6/23 (26%)
C2H2 Zn finger 543..563 CDD:275368 7/19 (37%)
C2H2 Zn finger 571..591 CDD:275368 9/20 (45%)
zf-H2C2_2 584..608 CDD:290200 10/24 (42%)
C2H2 Zn finger 599..619 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.