DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ham and ZNF665

DIOPT Version :9

Sequence 1:NP_724130.4 Gene:ham / 35135 FlyBaseID:FBgn0045852 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_001340387.1 Gene:ZNF665 / 79788 HGNCID:25885 Length:706 Species:Homo sapiens


Alignment Length:740 Identity:167/740 - (22%)
Similarity:251/740 - (33%) Gaps:252/740 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 GSLYSGDEFSKDKKNSSLIREGDIDFTDDENGFDIRCEVCDKVYPDLDLLDDHLIGAHHFKQDEF 369
            |.:|..::..|...|               .|...:|:.|.||:.....|..|  ...|..:..:
Human   187 GKIYEYNQVEKSPNN---------------RGKHYKCDECGKVFSQNSRLTSH--KRIHTGEKPY 234

  Fly   370 PCKQCALRFCHRPLLIKHEAISHNNIRKYSCENCSKVFCDPSNLQRHIRAYHVGARCHPCPECGK 434
            .|.:|...|..|..|..|:.| |...:.|.|..|.|||..||||..|.| .|.|.:.:.|.||||
Human   235 QCNKCGKAFTVRSNLTIHQVI-HTGEKPYKCNECGKVFSQPSNLAGHQR-IHTGEKPYKCNECGK 297

  Fly   435 TFGTSSGLKQHQHIHSSVKPFACEVCSKAYTQFSNLCRHKRMHATCRMQIKCDKCNQSFSTLTSL 499
            .|...|.|..||.||:..||:.|:.|.|.:||.|:|..|:|:| |.....||::|.::||..:||
Human   298 AFRAHSKLTTHQVIHTGEKPYKCKECGKCFTQNSHLASHRRIH-TGEKPYKCNECGKAFSVRSSL 361

  Fly   500 TKHKKFCDSTGPGPYR-NQ--HVNRHHQHPHQHPLPHQPHLAATATSTCPAPPRESSESSSSAAA 561
            |.|:..  .||..||: |:  .|.||:.:..:|...|                            
Human   362 TTHQTI--HTGEKPYKCNECGKVFRHNSYLAKHRRIH---------------------------- 396

  Fly   562 AAVAAMSTPPNPFLMFRTAPSFFPGFPPYGFPPFLPQNPLHPTNIPMFFSKNPMDLGCGGPEITS 626
                                   .|..||....                        ||      
Human   397 -----------------------TGEKPYKCNE------------------------CG------ 408

  Fly   627 PVSAFDQKLPFGFLKGENSESQAYDKVTEKELVFKAEEKLKKEPLVQAFEGEEDESRSSLDIKGK 691
              .||..                :..:|:.:::...|:..|....|:.|                
Human   409 --KAFSM----------------HSNLTKHQIIHTGEKPFKCNECVKVF---------------- 439

  Fly   692 LEDTRNDSKSEEQDDMKQEPERVSTPDQ-QQAEDDRKSIDIMSTPPPADTPSGGDGPLDLSICRK 755
                       .|........|:.|.:: .:.::..|:..:.|:.........|:.|...:.|  
Human   440 -----------TQYSHLANHRRIHTGEKPYRCDECGKAFSVRSSLTTHQAIHTGEKPYKCNDC-- 491

  Fly   756 RSAGSFFTAPAEDNLMLHRFMPRLHEFEAERGQPLKMRKSHSSAESSTSQ-----KSHKGSSPTP 815
               |..||  ...:|..||   .:|..|    :|.|..:. ..|.|.|||     :.|.|..|  
Human   492 ---GKVFT--QNSHLASHR---GIHSGE----KPYKCDEC-GKAFSQTSQLARHWRVHTGEKP-- 541

  Fly   816 TPTASPGLTPSPSPPTSAGGELSSTSEGGAVPTMAAAAFAADHSALASGPTLPQTHPTFHP---- 876
                                  ...:|.|       .||:. ||:|.       .|.|.|.    
Human   542 ----------------------YKCNECG-------KAFSV-HSSLT-------IHQTIHTGQKP 569

  Fly   877 ----------------LLLEEIYRSGFPFLCQPGGRR-GIEALLAGAASAAAPKRPLPPVKFSAG 924
                            .:.:.|:....|:.|...|:. .:.:.||........::|         
Human   570 YKCNDCGKVFRHNSYLAIHQRIHTGEKPYKCNECGKAFSVHSNLATHQVIHTGEKP--------- 625

  Fly   925 SVVGLKTKDRYSCKFCGKVFPRSANLTRHLRTHTGEQPYPCKYCDRAFSISSNLQRHVRNIHNKE 989
                      |.|..|||||.::::|..|.|.||||:||.|..|.:|||:.|.|..|:. :|..:
Human   626 ----------YKCNECGKVFTQNSHLANHRRIHTGEKPYRCNECGKAFSVRSTLTTHMA-VHTGD 679

  Fly   990 RPFRCELCDRSFGQQTNLDRHVKKH 1014
            :|::|..|.:.|.|.:||.:|.:.|
Human   680 KPYKCNQCGKVFTQNSNLAKHRRIH 704

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hamNP_724130.4 PR-SET_ZFPM 131..253 CDD:380978
C2H2 Zn finger 341..363 CDD:275368 6/21 (29%)
C2H2 Zn finger 371..392 CDD:275368 7/20 (35%)
SFP1 <391..479 CDD:227516 39/87 (45%)
C2H2 Zn finger 400..421 CDD:275368 11/20 (55%)
SUF4-like 403..>445 CDD:411020 20/41 (49%)
C2H2 Zn finger 403..421 CDD:411020 10/17 (59%)
C2H2 Zn finger 429..449 CDD:275368 10/19 (53%)
C2H2 Zn finger 457..477 CDD:275368 9/19 (47%)
C2H2 Zn finger 486..504 CDD:275368 8/17 (47%)
PTZ00121 <641..>728 CDD:173412 8/87 (9%)
COG5048 935..>1028 CDD:227381 34/80 (43%)
zf-C2H2 935..957 CDD:395048 10/21 (48%)
C2H2 Zn finger 937..957 CDD:275368 9/19 (47%)
zf-H2C2_2 949..973 CDD:404364 12/23 (52%)
C2H2 Zn finger 965..986 CDD:275368 8/20 (40%)
C2H2 Zn finger 994..1014 CDD:275368 7/19 (37%)
ZNF665NP_001340387.1 KRAB 37..76 CDD:307490
COG5048 192..580 CDD:227381 124/589 (21%)
C2H2 Zn finger 208..228 CDD:275368 6/21 (29%)
C2H2 Zn finger 236..256 CDD:275368 7/20 (35%)
C2H2 Zn finger 264..284 CDD:275368 11/20 (55%)
C2H2 Zn finger 292..312 CDD:275368 10/19 (53%)
C2H2 Zn finger 320..340 CDD:275368 9/19 (47%)
C2H2 Zn finger 348..368 CDD:275368 8/21 (38%)
C2H2 Zn finger 376..396 CDD:275368 5/19 (26%)
C2H2 Zn finger 404..424 CDD:275368 5/67 (7%)
C2H2 Zn finger 432..452 CDD:275368 4/46 (9%)
C2H2 Zn finger 460..480 CDD:275368 2/19 (11%)
C2H2 Zn finger 488..508 CDD:275368 7/29 (24%)
C2H2 Zn finger 516..536 CDD:275368 5/20 (25%)
C2H2 Zn finger 544..564 CDD:275368 9/34 (26%)
C2H2 Zn finger 572..592 CDD:275368 0/19 (0%)
zf-H2C2_2 584..608 CDD:316026 4/23 (17%)
C2H2 Zn finger 600..620 CDD:275368 4/19 (21%)
zf-H2C2_2 612..637 CDD:316026 10/43 (23%)
C2H2 Zn finger 628..648 CDD:275368 9/19 (47%)
zf-H2C2_2 640..664 CDD:316026 12/23 (52%)
C2H2 Zn finger 656..676 CDD:275368 8/20 (40%)
zf-H2C2_2 669..693 CDD:316026 7/24 (29%)
C2H2 Zn finger 684..704 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.