DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ham and ZNF28

DIOPT Version :9

Sequence 1:NP_724130.4 Gene:ham / 35135 FlyBaseID:FBgn0045852 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_008900.3 Gene:ZNF28 / 7576 HGNCID:13073 Length:718 Species:Homo sapiens


Alignment Length:714 Identity:153/714 - (21%)
Similarity:251/714 - (35%) Gaps:224/714 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 EFSKDKKNSSLIREGDIDFTDDENGFDIRCEVCDKVYPDLDLLDDHLIGAHHFKQDEFPCKQCAL 376
            |..|....|||:::..|...:::   ..:|:|..||:.....|..|  ...|..:..:.|.:|..
Human   219 ESGKSFNCSSLLKKHQITHLEEK---QCKCDVYGKVFNQKRYLACH--RRSHIDEKPYKCNECGK 278

  Fly   377 RFCHRPLLIKHEAISHNNIRKYSCENCSKVFCDPSNLQRHIRAYHVGARCHPCPECGKTFGTSSG 441
            .|.|...|..|:|: |...:.|.||.|.|||...|:|:.| :..:.|.:.:.|..|.|.|..:|.
Human   279 IFGHNTSLFLHKAL-HTADKPYECEECDKVFSRKSHLETH-KIIYTGGKPYKCKVCDKAFTCNSY 341

  Fly   442 LKQHQHIHSSVKPFACEVCSKAYTQFSNLCRHKRMHATCRMQIKCDKCNQSFSTLTSLTKHKKFC 506
            |.:|..||:..||:.|..|.|.:.:.|.|.||:|:| |.....:|::|.:.||..:.|.:||:. 
Human   342 LAKHTIIHTGEKPYKCNECGKVFNRLSTLARHRRLH-TGEKPYECEECEKVFSRKSHLERHKRI- 404

  Fly   507 DSTGPGPYRNQHVNR---HHQHPHQHPLPHQPHLAATATSTCPAPPRESSESSSSAAAAAVAAMS 568
             .||..||:.:..::   ::.:..:|.:.|                                   
Human   405 -HTGEKPYKCKVCDKAFAYNSYLAKHSIIH----------------------------------- 433

  Fly   569 TPPNPFLMFRTAPSFFPGFPPYGFPPFLPQNPLHPTNIPMFFSKNPMDLGCGGPEITSPVSAFDQ 633
                            .|..||....                        ||        ..|:|
Human   434 ----------------TGEKPYKCNE------------------------CG--------KVFNQ 450

  Fly   634 KLPFGFLKGENSESQAYDKVTEKELVFKAEEKLKKEPLVQAFEGEEDESRSSLDIKGKLEDTRND 698
            :.........::..:.| |..|.:.||:.:..|::...:..  ||:       ..|.|:.|    
Human   451 QSTLARHHRLHTAEKPY-KCEECDKVFRCKSHLERHRRIHT--GEK-------PYKCKVCD---- 501

  Fly   699 SKSEEQDDMKQEPERVSTPDQQQAEDDRKSIDIMSTPPPADTPSGGDGPLDLSICRKRSAGSFFT 763
             |:...|....|.:||.|                           |:.|...:.|     |..|:
Human   502 -KAFRSDSCLTEHQRVHT---------------------------GEKPYMCNEC-----GKVFS 533

  Fly   764 APAEDNLMLHRFMPRLH----EFEAERGQPLKMRKSHSSAESSTSQKSHKGSSPTPTPTASPGLT 824
            ..|  ||..|.   :||    .::.|..:.:..||||....    ::.|.|..|.......    
Human   534 TKA--NLACHH---KLHTAEKPYKCEECEKVFSRKSHMERH----RRIHTGEKPYKCKVCD---- 585

  Fly   825 PSPSPPTSAGGELSSTSEGGAVPTMAAAAFAADHSALASGPTLPQTHPTFHPLLLEEIYRSGFPF 889
                                       .||..|            :|...|    :.::....|:
Human   586 ---------------------------KAFRRD------------SHLAQH----QRVHTGEKPY 607

  Fly   890 LCQPGGRRGIEALLAGAASAAAPKRPLPPVKFSAGSVVGLKTKDR-YSCKFCGKVFPRSANLTRH 953
            .|...|:     .....:|....:|              |.|.:: |.|..|||.|.:.::|..|
Human   608 KCNECGK-----TFRQTSSLIIHRR--------------LHTGEKPYKCNECGKTFSQMSSLVYH 653

  Fly   954 LRTHTGEQPYPCKYCDRAFSISSNLQRHVRNIHNKERPFRCELCDRSFGQQTNLDRHVKKHESE 1017
            .|.|:||:||.|..|.:.|:..::|.:|.| :|..|:|::|..|.::|.|.:||..|.:.|..|
Human   654 HRLHSGEKPYKCNECGKVFNQQAHLAQHQR-VHTGEKPYKCNECGKTFSQMSNLVYHHRLHSGE 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hamNP_724130.4 PR-SET_ZFPM 131..253 CDD:380978
C2H2 Zn finger 341..363 CDD:275368 6/21 (29%)
C2H2 Zn finger 371..392 CDD:275368 7/20 (35%)
SFP1 <391..479 CDD:227516 32/87 (37%)
C2H2 Zn finger 400..421 CDD:275368 9/20 (45%)
SUF4-like 403..>445 CDD:411020 14/41 (34%)
C2H2 Zn finger 403..421 CDD:411020 7/17 (41%)
C2H2 Zn finger 429..449 CDD:275368 7/19 (37%)
C2H2 Zn finger 457..477 CDD:275368 8/19 (42%)
C2H2 Zn finger 486..504 CDD:275368 6/17 (35%)
PTZ00121 <641..>728 CDD:173412 17/86 (20%)
COG5048 935..>1028 CDD:227381 32/83 (39%)
zf-C2H2 935..957 CDD:395048 9/21 (43%)
C2H2 Zn finger 937..957 CDD:275368 8/19 (42%)
zf-H2C2_2 949..973 CDD:404364 10/23 (43%)
C2H2 Zn finger 965..986 CDD:275368 6/20 (30%)
C2H2 Zn finger 994..1014 CDD:275368 7/19 (37%)
ZNF28NP_008900.3 KRAB 8..>48 CDD:214630
KRAB 8..47 CDD:279668
COG5048 <143..373 CDD:227381 48/160 (30%)
C2H2 Zn finger 217..237 CDD:275368 6/17 (35%)
C2H2 Zn finger 245..265 CDD:275368 6/21 (29%)
COG5048 267..655 CDD:227381 116/597 (19%)
C2H2 Zn finger 273..293 CDD:275368 7/20 (35%)
C2H2 Zn finger 301..321 CDD:275368 9/20 (45%)
C2H2 Zn finger 329..349 CDD:275368 7/19 (37%)
zf-H2C2_2 341..366 CDD:290200 9/24 (38%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
zf-H2C2_2 370..394 CDD:290200 9/24 (38%)
C2H2 Zn finger 385..405 CDD:275368 7/21 (33%)
zf-H2C2_2 397..422 CDD:290200 7/26 (27%)
C2H2 Zn finger 413..433 CDD:275368 1/19 (5%)
zf-H2C2_2 425..450 CDD:290200 8/107 (7%)
C2H2 Zn finger 441..461 CDD:275368 4/51 (8%)
C2H2 Zn finger 469..489 CDD:275368 4/19 (21%)
zf-H2C2_2 481..506 CDD:290200 7/38 (18%)
C2H2 Zn finger 497..517 CDD:275368 6/24 (25%)
zf-H2C2_2 510..534 CDD:290200 9/55 (16%)
C2H2 Zn finger 525..545 CDD:275368 7/29 (24%)
C2H2 Zn finger 553..573 CDD:275368 5/23 (22%)
zf-H2C2_2 565..590 CDD:290200 6/59 (10%)
C2H2 Zn finger 581..601 CDD:275368 5/66 (8%)
zf-H2C2_2 593..618 CDD:290200 5/33 (15%)
C2H2 Zn finger 609..629 CDD:275368 4/38 (11%)
zf-H2C2_2 621..646 CDD:290200 10/38 (26%)
C2H2 Zn finger 637..657 CDD:275368 8/19 (42%)
C2H2 Zn finger 665..685 CDD:275368 6/20 (30%)
zf-H2C2_2 677..702 CDD:290200 9/25 (36%)
C2H2 Zn finger 693..713 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.