DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ham and ZNF726

DIOPT Version :9

Sequence 1:NP_724130.4 Gene:ham / 35135 FlyBaseID:FBgn0045852 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_001230967.1 Gene:ZNF726 / 730087 HGNCID:32462 Length:616 Species:Homo sapiens


Alignment Length:670 Identity:151/670 - (22%)
Similarity:229/670 - (34%) Gaps:239/670 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 HFKQDEFPCKQCALRFCHRPLLIKHEAISHNNIRKYSCENCSKVFCDPSNLQRHIRAYHVGARCH 427
            |.::..|.||.|...||......:|::| :...:.|.|:.|.|.|...|.|..| :..|...:.:
Human   167 H
TRKKPFKCKNCVKSFCMFSHKTQHKSI-YTTEKSYKCKECGKTFNWSSTLTNH-KKTHTEEKPY 229

  Fly   428 PCPECGKTFGTSSGLKQHQHIHSSVKPFACEVCSKAYTQFSNLCRHKRMHATCRMQIKCDKCNQS 492
            .|.|.||.|..||....|:..|:..||:.||.|.||::|.|.|..|||:| |.....||::|.::
Human   230 KCEEYGKAFNQSSNYTTHKVTHTGEKPYKCEECGKAFSQSSTLTIHKRIH-TGEKPCKCEECGKA 293

  Fly   493 FSTLTSLTKHKKFCDSTGPGPYRNQHVNR---------HHQHPHQHPLPHQPHLAATATSTCPAP 548
            ||..::||.||:.  ..|..||:.:...:         .|:..|....|::....|.|.|     
Human   294 FSQPSALTIHKRM--HIGEKPYKCEECGKAFVWSSTLTRHKRLHSGEKPYKCEECAKAFS----- 351

  Fly   549 PRESSESSSSAAAAAVAAMSTPPNPFLMFRTAPSFFPGFPPYGFPPFLPQNPLHPTNIPMFFSKN 613
                                    .|....|......|..||....                   
Human   352 ------------------------QFGHLTTHRIIHTGEKPYKCEE------------------- 373

  Fly   614 PMDLGCGGPEITSPVSAFDQKLPFGFLKGENSESQAY---DKVTEKELVFKAEEKLKKEPLVQAF 675
                 ||                           :|:   ..:|:.:.:...|:..|.|...:||
Human   374 -----CG---------------------------KAFIWPSTLTKHKRIHTGEKPYKCEECGKAF 406

  Fly   676 EGEEDESRSSLDIKGKLEDTRNDSKSEEQDDMKQEPERVSTPDQQQAEDDRKSIDIMSTPPPADT 740
            .      |||...|.|:..|                                             
Human   407 H------RSSNLTKHKIIHT--------------------------------------------- 420

  Fly   741 PSGGDGPLDLSICRKRSAGSFFTAPAEDNLMLHRFMPRLHEFEAERGQPLKMRK-----SHSSAE 800
               |:.|.....|.|....|       .||..|:   ::|    .|.:|.|..:     |.||| 
Human   421 ---GEKPYKCEECGKAFIWS-------SNLTEHK---KIH----TREKPYKCEECSKAFSRSSA- 467

  Fly   801 SSTSQKSHKGSSPTPTPTASPGLTPSPSPPTSAGGELSSTSEGGAVPTMAAAAFAADHSALASGP 865
            .:|.::.|.|..|                        ....|.|              .|.:...
Human   468 LTTHKRMHTGEKP------------------------YKCEECG--------------KAFSQSS 494

  Fly   866 TLPQTHPTFHPLLLEEIYRSGFPFLCQPGGRRGIEALLAGAASAAAPKRPLPPVKFSAGSVVGLK 930
            ||     |.|.:    |:....|:.|:..|:..|.     :::.:..||              :.
Human   495 TL-----TAHKI----IHTGEKPYKCEECGKAFIL-----SSTLSKHKR--------------IH 531

  Fly   931 TKDR-YSCKFCGKVFPRSANLTRHLRTHTGEQPYPCKYCDRAFSISSNLQRHVRNIHNKERPFRC 994
            |.:: |.|:.|||.|.:|:||:.|...||||:||.|:.|.:||:.||||..| :.||..|:|::|
Human   532 TGEKPYKCEECGKTFNQSSNLSTHKIIHTGEKPYKCEECGKAFNRSSNLSTH-KIIHTGEKPYKC 595

  Fly   995 ELCDRSFGQQTNLDRHVKKH 1014
            :.|.:||...:.|.:|.:.|
Human   596 DECGKSFIWSSTLFKHKRIH 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hamNP_724130.4 PR-SET_ZFPM 131..253 CDD:380978
C2H2 Zn finger 341..363 CDD:275368 151/670 (23%)
C2H2 Zn finger 371..392 CDD:275368 7/20 (35%)
SFP1 <391..479 CDD:227516 32/87 (37%)
C2H2 Zn finger 400..421 CDD:275368 7/20 (35%)
SUF4-like 403..>445 CDD:411020 14/41 (34%)
C2H2 Zn finger 403..421 CDD:411020 6/17 (35%)
C2H2 Zn finger 429..449 CDD:275368 8/19 (42%)
C2H2 Zn finger 457..477 CDD:275368 11/19 (58%)
C2H2 Zn finger 486..504 CDD:275368 7/17 (41%)
PTZ00121 <641..>728 CDD:173412 13/89 (15%)
COG5048 935..>1028 CDD:227381 36/80 (45%)
zf-C2H2 935..957 CDD:395048 10/21 (48%)
C2H2 Zn finger 937..957 CDD:275368 9/19 (47%)
zf-H2C2_2 949..973 CDD:404364 12/23 (52%)
C2H2 Zn finger 965..986 CDD:275368 9/20 (45%)
C2H2 Zn finger 994..1014 CDD:275368 6/19 (32%)
ZNF726NP_001230967.1 KRAB 4..64 CDD:214630
KRAB 4..43 CDD:279668
C2H2 Zn finger 145..167 CDD:275368 151/670 (23%)
C2H2 Zn finger 175..195 CDD:275368 7/20 (35%)
COG5048 186..612 CDD:227381 142/646 (22%)
C2H2 Zn finger 203..223 CDD:275368 7/20 (35%)
C2H2 Zn finger 231..251 CDD:275368 8/19 (42%)
zf-H2C2_2 243..268 CDD:290200 9/24 (38%)
C2H2 Zn finger 259..279 CDD:275368 11/19 (58%)
zf-H2C2_2 272..296 CDD:290200 10/24 (42%)
C2H2 Zn finger 287..307 CDD:275368 8/21 (38%)
zf-H2C2_2 299..323 CDD:290200 7/25 (28%)
C2H2 Zn finger 315..335 CDD:275368 1/19 (5%)
zf-H2C2_2 328..352 CDD:290200 6/52 (12%)
C2H2 Zn finger 343..363 CDD:275368 5/48 (10%)
zf-H2C2_2 355..378 CDD:290200 6/73 (8%)
C2H2 Zn finger 371..391 CDD:275368 4/70 (6%)
zf-H2C2_2 384..408 CDD:290200 6/29 (21%)
C2H2 Zn finger 399..419 CDD:275368 8/25 (32%)
zf-H2C2_2 411..434 CDD:290200 7/70 (10%)
C2H2 Zn finger 427..447 CDD:275368 6/29 (21%)
zf-H2C2_2 439..464 CDD:290200 7/31 (23%)
C2H2 Zn finger 455..475 CDD:275368 5/20 (25%)
zf-H2C2_2 467..492 CDD:290200 8/63 (13%)
C2H2 Zn finger 483..503 CDD:275368 7/42 (17%)
zf-H2C2_2 496..518 CDD:290200 7/30 (23%)
C2H2 Zn finger 511..531 CDD:275368 5/38 (13%)
zf-H2C2_2 524..548 CDD:290200 9/37 (24%)
C2H2 Zn finger 539..559 CDD:275368 9/19 (47%)
zf-H2C2_2 551..576 CDD:290200 13/24 (54%)
C2H2 Zn finger 567..587 CDD:275368 9/20 (45%)
zf-H2C2_2 579..602 CDD:290200 9/23 (39%)
C2H2 Zn finger 595..615 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.