DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ham and ZNF571

DIOPT Version :9

Sequence 1:NP_724130.4 Gene:ham / 35135 FlyBaseID:FBgn0045852 Length:1108 Species:Drosophila melanogaster
Sequence 2:XP_016882344.1 Gene:ZNF571 / 51276 HGNCID:25000 Length:651 Species:Homo sapiens


Alignment Length:718 Identity:155/718 - (21%)
Similarity:235/718 - (32%) Gaps:263/718 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 VCDKVYPDLDLLDDHLIGA--HHF---KQDEFPCKQCALRFCHRPLLIKHEAISHNNIRKYSCEN 402
            :|.|:..:....:.|...:  |..   |:..:.||:|...|.:...||:||. :||      .|.
Human   150 MCVKITCEEKATESHSTSSTFHRIIPTKEKLYKCKECRQGFSYLSCLIQHEE-NHN------IEK 207

  Fly   403 CSKV------FCDPSNLQRHIRAYHVGARCHPCPECGKTFGTSSGLKQHQHIHSSVKPFACEVCS 461
            ||:|      |....:..:|.| ...|.:.:.|.||||.||.:|.|.|||.||::.||:.|..|.
Human   208 CSEVKKHRNTFSKKPSYIQHQR-IQTGEKPYECMECGKAFGRTSDLIQHQKIHTNEKPYQCNACG 271

  Fly   462 KAYTQFSNLCRHKRMHATCRMQIKCDKCNQSFSTLTSLTKHKKFCDSTGPGPYRNQHVNR----- 521
            ||:.:.|.|..|:|:| |.....:|.||.::||..:..|.|::.  .:|..||..:...:     
Human   272 KAFIRGSQLTEHQRVH-TGEKPYECKKCGKAFSYCSQYTLHQRI--HSGEKPYECKDCGKAFILG 333

  Fly   522 ----HHQHPHQHPLPHQPHLAATATSTCPAPPRESSESSSSAAAAAVAAMSTPPNPFLMFRTAPS 582
                :||..|....|:                 |..|                            
Human   334 SQLTYHQRIHSGEKPY-----------------ECKE---------------------------- 353

  Fly   583 FFPGFPPYGFPPFLPQNPLHPTNIPMFFSKNPMDLGCGGPEITSPVSAFDQKLPFGFLKGENSES 647
                                                ||...|......:.|::..|         
Human   354 ------------------------------------CGKAFILGSHLTYHQRVHTG--------- 373

  Fly   648 QAYDKVTEKELVFKAEEKLKKEPLVQAFEGEEDESRSSLDIKGKLEDTRNDSKSEEQDDMKQEPE 712
                                ::|.:....|:.....|.|:                      |.:
Human   374 --------------------EKPYICKECGKAFLCASQLN----------------------EHQ 396

  Fly   713 RVSTPDQQQAEDDRKSIDIMSTPPPADTPSGGDGPLDLSICRKRSAGSFFTAPAEDNLMLHRFMP 777
            |:.|                           |:.|.:...|.|    :||..   ..|..|.   
Human   397 RIHT---------------------------GEKPYECKECGK----TFFRG---SQLTYHL--- 424

  Fly   778 RLHEFEAERGQPLKMRKSHSSAESSTS----QKSHKGSSPTPTPTASPGLTPSPSPPTSAGGELS 838
            |:|..|    :|.|.::...:..|:::    |:.|.|..|...........        .|.:||
Human   425 RVHSGE----RPYKCKECGKAFISNSNLIQHQRIHTGEKPYKCKECGKAFI--------CGKQLS 477

  Fly   839 STS--EGGAVP--------TMAAAAFAADHSAL---------ASGPTLPQ-THPTFHPLLLEEIY 883
            ...  ..|..|        .....|:...|..:         ..|.|..: |..|:|    :.|:
Human   478 EHQRIHTGEKPFECKECGKAFIRVAYLTQHEKIHGEKHYECKECGKTFVRATQLTYH----QRIH 538

  Fly   884 RSGFPFLCQPGGRRGIEALLAGAASAAAPK--RPLPPVKFSAGSVVGLKTKDRYSCKFCGKVFPR 946
            ....|:.|:...:    |.:.|:..:...:  |...|                |.||.|||.|.|
Human   539 TGEKPYKCKECDK----AFIYGSQLSEHQRIHRGEKP----------------YECKQCGKAFIR 583

  Fly   947 SANLTRHLRTHTGEQPYPCKYCDRAFSISSNLQRHVRNIHNKERPFRCELCDRSFGQQTNLDRHV 1011
            .::||.||||||||:||.||.|.||||..|.|..|.| ||..|:|:.|..|.:.|...:.|.:|.
Human   584 GSHLTEHLRTHTGEKPYECKECGRAFSRGSELTLHQR-IHTGEKPYTCVQCGKDFRCPSQLTQHT 647

  Fly  1012 KKH 1014
            :.|
Human   648 RLH 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hamNP_724130.4 PR-SET_ZFPM 131..253 CDD:380978
C2H2 Zn finger 341..363 CDD:275368 3/21 (14%)
C2H2 Zn finger 371..392 CDD:275368 8/20 (40%)
SFP1 <391..479 CDD:227516 35/93 (38%)
C2H2 Zn finger 400..421 CDD:275368 7/26 (27%)
SUF4-like 403..>445 CDD:411020 16/47 (34%)
C2H2 Zn finger 403..421 CDD:411020 6/23 (26%)
C2H2 Zn finger 429..449 CDD:275368 12/19 (63%)
C2H2 Zn finger 457..477 CDD:275368 8/19 (42%)
C2H2 Zn finger 486..504 CDD:275368 7/17 (41%)
PTZ00121 <641..>728 CDD:173412 7/86 (8%)
COG5048 935..>1028 CDD:227381 41/80 (51%)
zf-C2H2 935..957 CDD:395048 13/21 (62%)
C2H2 Zn finger 937..957 CDD:275368 12/19 (63%)
zf-H2C2_2 949..973 CDD:404364 17/23 (74%)
C2H2 Zn finger 965..986 CDD:275368 11/20 (55%)
C2H2 Zn finger 994..1014 CDD:275368 5/19 (26%)
ZNF571XP_016882344.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.