| Sequence 1: | NP_724130.4 | Gene: | ham / 35135 | FlyBaseID: | FBgn0045852 | Length: | 1108 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001156895.1 | Gene: | ZNF580 / 51157 | HGNCID: | 29473 | Length: | 172 | Species: | Homo sapiens |
| Alignment Length: | 204 | Identity: | 58/204 - (28%) |
|---|---|---|---|
| Similarity: | 78/204 - (38%) | Gaps: | 47/204 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 823 LTPSPSPPTSAGGELSSTSEGGAVPTMAAAAFAADHSALASGPTLPQ--TH--------PTFHPL 877
Fly 878 LLEEIYRSGFPFLCQPGGRRGIEALLAGAASAAAPKRPLPPVKFSAGSVVGLKTKDRYSCKFCGK 942
Fly 943 VFPRSANLTRHLRTHTGEQPYPCKYCDRAFSISSNLQRHVRNIHNKER--PFRCELCDRSFGQQT 1005
Fly 1006 NLDRHVKKH 1014 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ham | NP_724130.4 | PR-SET_ZFPM | 131..253 | CDD:380978 | |
| C2H2 Zn finger | 341..363 | CDD:275368 | |||
| C2H2 Zn finger | 371..392 | CDD:275368 | |||
| SFP1 | <391..479 | CDD:227516 | |||
| C2H2 Zn finger | 400..421 | CDD:275368 | |||
| SUF4-like | 403..>445 | CDD:411020 | |||
| C2H2 Zn finger | 403..421 | CDD:411020 | |||
| C2H2 Zn finger | 429..449 | CDD:275368 | |||
| C2H2 Zn finger | 457..477 | CDD:275368 | |||
| C2H2 Zn finger | 486..504 | CDD:275368 | |||
| PTZ00121 | <641..>728 | CDD:173412 | |||
| COG5048 | 935..>1028 | CDD:227381 | 31/82 (38%) | ||
| zf-C2H2 | 935..957 | CDD:395048 | 8/21 (38%) | ||
| C2H2 Zn finger | 937..957 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 949..973 | CDD:404364 | 7/23 (30%) | ||
| C2H2 Zn finger | 965..986 | CDD:275368 | 10/20 (50%) | ||
| C2H2 Zn finger | 994..1014 | CDD:275368 | 8/19 (42%) | ||
| ZNF580 | NP_001156895.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..93 | 27/122 (22%) | |
| C2H2 Zn finger | 94..114 | CDD:275368 | 6/19 (32%) | ||
| zf-C2H2 | 120..142 | CDD:395048 | 10/22 (45%) | ||
| C2H2 Zn finger | 122..142 | CDD:275368 | 10/20 (50%) | ||
| C2H2 Zn finger | 152..172 | CDD:275368 | 8/19 (42%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||