DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ham and ZNF727

DIOPT Version :9

Sequence 1:NP_724130.4 Gene:ham / 35135 FlyBaseID:FBgn0045852 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_001152994.1 Gene:ZNF727 / 442319 HGNCID:22785 Length:499 Species:Homo sapiens


Alignment Length:248 Identity:80/248 - (32%)
Similarity:113/248 - (45%) Gaps:30/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 DRSDRDNGSLYSGDEFSKDKKNSSLIREGDIDFTDDENGFDIRCEVCDKVYPDLDLLDDHLIGAH 362
            |||       |..:|..|..|..|.:.|.:...|..:   ..:||.|.|.:.....|..|  ..:
Human   197 DRS-------YKCEECGKACKKFSNLTEHNRVHTGKK---PYKCEECGKTFTCSSALTKH--KRN 249

  Fly   363 HFKQDEFPCKQC--ALRFCHRPLLIKHEAISHNNIRKYSCENCSKVFCDPSNLQRHIRAYHVGAR 425
            |.....:.|::|  |.|.|..  |.||:.| |...:.|.|:.|.|.|...|:|.:|.| .|.|.:
Human   250 HTGDRPYKCEECHKAFRCCSD--LTKHKRI-HTGEKPYKCKECHKAFRCCSDLTKHKR-IHTGEK 310

  Fly   426 CHPCPECGKTFGTSSGLKQHQHIHSSVKPFACEVCSKAYTQFSNLCRHKRMHATCRMQIKCDKCN 490
            .:.|.||||.|...|.|.||..||:..||:.||.|.||:|..|.|..|||:|...| ..||::|.
Human   311 PYKCNECGKAFMWISALSQHNRIHTGEKPYICEECGKAFTYSSTLISHKRIHMELR-PYKCEECG 374

  Fly   491 QSFSTLTSLTKHKKFCDSTGPGPYRNQHVNR---------HHQHPHQHPLPHQ 534
            ::|...:.||.||:.  .||..||:.:...:         .|:..|....|::
Human   375 KTFKWFSDLTNHKRI--HTGEKPYKCEECGKSFTCSSNLIKHKRIHMEVRPYK 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hamNP_724130.4 PR-SET_ZFPM 131..253 CDD:380978
C2H2 Zn finger 341..363 CDD:275368 6/21 (29%)
C2H2 Zn finger 371..392 CDD:275368 9/22 (41%)
SFP1 <391..479 CDD:227516 38/87 (44%)
C2H2 Zn finger 400..421 CDD:275368 8/20 (40%)
SUF4-like 403..>445 CDD:411020 17/41 (41%)
C2H2 Zn finger 403..421 CDD:411020 7/17 (41%)
C2H2 Zn finger 429..449 CDD:275368 10/19 (53%)
C2H2 Zn finger 457..477 CDD:275368 11/19 (58%)
C2H2 Zn finger 486..504 CDD:275368 6/17 (35%)
PTZ00121 <641..>728 CDD:173412
COG5048 935..>1028 CDD:227381
zf-C2H2 935..957 CDD:395048
C2H2 Zn finger 937..957 CDD:275368
zf-H2C2_2 949..973 CDD:404364
C2H2 Zn finger 965..986 CDD:275368
C2H2 Zn finger 994..1014 CDD:275368
ZNF727NP_001152994.1 KRAB 4..64 CDD:214630
KRAB 4..43 CDD:279668
C2H2 Zn finger 148..167 CDD:275370
C2H2 Zn finger 175..194 CDD:275368
C2H2 Zn finger 202..222 CDD:275368 5/19 (26%)
zf-H2C2_2 214..239 CDD:290200 6/27 (22%)
COG5048 <226..409 CDD:227381 67/194 (35%)
C2H2 Zn finger 230..250 CDD:275368 6/21 (29%)
zf-H2C2_2 242..267 CDD:290200 6/26 (23%)
C2H2 Zn finger 258..278 CDD:275368 9/22 (41%)
zf-H2C2_2 270..295 CDD:290200 10/27 (37%)
C2H2 Zn finger 286..306 CDD:275368 8/20 (40%)
zf-H2C2_2 298..321 CDD:290200 10/23 (43%)
C2H2 Zn finger 314..334 CDD:275368 10/19 (53%)
zf-H2C2_2 326..351 CDD:290200 12/24 (50%)
C2H2 Zn finger 342..362 CDD:275368 11/19 (58%)
C2H2 Zn finger 370..390 CDD:275368 7/21 (33%)
zf-H2C2_2 382..407 CDD:290200 8/26 (31%)
C2H2 Zn finger 398..418 CDD:275368 1/19 (5%)
C2H2 Zn finger 426..446 CDD:275368 80/248 (32%)
zf-H2C2_2 438..463 CDD:290200
C2H2 Zn finger 454..474 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.