DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ham and CG17806

DIOPT Version :9

Sequence 1:NP_724130.4 Gene:ham / 35135 FlyBaseID:FBgn0045852 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster


Alignment Length:146 Identity:43/146 - (29%)
Similarity:64/146 - (43%) Gaps:5/146 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 CEVCDKVYPDLDLLDDHLIGAHHFKQDEFPCKQCALRFCHRPLLIKHEAISHNNIRKYSCENCSK 405
            |:.|.|.:.:....:.||  ..|....||.|::|......:.||..|..|.|.....|.|:.|.|
  Fly   262 CDQCGKTFSEKGNFNVHL--RRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGK 324

  Fly   406 VFCDPSNLQRHIRAYHVGA--RCHPCPECGKTFGTSSGLKQHQHIHSSVKPFACEVCSKAYTQFS 468
            .|.:......|.|.:....  |.|.|..|.|.|.||:.||.|..:|:..:||.||:|...:.:.:
  Fly   325 RFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRN 389

  Fly   469 NLCRH-KRMHATCRMQ 483
            .|..| |..|...:::
  Fly   390 ALATHYKSKHHRLKVE 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hamNP_724130.4 PR-SET_ZFPM 131..253 CDD:380978
C2H2 Zn finger 341..363 CDD:275368 5/21 (24%)
C2H2 Zn finger 371..392 CDD:275368 6/20 (30%)
SFP1 <391..479 CDD:227516 29/90 (32%)
C2H2 Zn finger 400..421 CDD:275368 6/20 (30%)
SUF4-like 403..>445 CDD:411020 15/43 (35%)
C2H2 Zn finger 403..421 CDD:411020 5/17 (29%)
C2H2 Zn finger 429..449 CDD:275368 9/19 (47%)
C2H2 Zn finger 457..477 CDD:275368 6/20 (30%)
C2H2 Zn finger 486..504 CDD:275368
PTZ00121 <641..>728 CDD:173412
COG5048 935..>1028 CDD:227381
zf-C2H2 935..957 CDD:395048
C2H2 Zn finger 937..957 CDD:275368
zf-H2C2_2 949..973 CDD:404364
C2H2 Zn finger 965..986 CDD:275368
C2H2 Zn finger 994..1014 CDD:275368
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523 5/21 (24%)
C2H2 Zn finger 262..282 CDD:275368 5/21 (24%)
C2H2 Zn finger 290..311 CDD:275368 6/20 (30%)
COG5048 <298..>383 CDD:227381 29/84 (35%)
C2H2 Zn finger 319..339 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 9/19 (47%)
ZnF_U1 375..407 CDD:197732 9/31 (29%)
C2H2 Zn finger 378..396 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.