DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ham and hb

DIOPT Version :9

Sequence 1:NP_724130.4 Gene:ham / 35135 FlyBaseID:FBgn0045852 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster


Alignment Length:1030 Identity:195/1030 - (18%)
Similarity:306/1030 - (29%) Gaps:388/1030 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 FAAR------HHL--------PQQEPVEGSPPRRDHLDIQDQELLHHPNHFHQQNQRQQPPPPTL 102
            |||.      |||        |:|.|:    |..:||    ::.|.     .||.|.||.|..||
  Fly    23 FAANIKQEPGHHLDGNSVASSPRQSPI----PSTNHL----EQFLK-----QQQQQLQQQPMDTL 74

  Fly   103 PLSVESSSAAAASVDGMDAFFKDRAQAEHILQEWVRRREPVCELDIRDSGGVYAKTPLQRGTRYG 167
                                                     |           |.||        
  Fly    75 -----------------------------------------C-----------AMTP-------- 79

  Fly   168 PFPMKLSHQPNDPQLAWKAHSRHYNGWLEPTEDVSTWLKKIRSVQDDCIGEANLQSYINAGYLWY 232
                  |...||     :...:||:.                ::|...:.:...|.:..|....:
  Fly    80 ------SPSQND-----QNSLQHYDA----------------NLQQQLLQQQQYQQHFQAAQQQH 117

  Fly   233 ETNRYVNAG-SEMVVDGRPKSPVQLNEDFMNGGKV--------LAAAAAAAAAVVAASS------ 282
            ..:.::..| :.:...|.| :|:|    ...||.:        .:|:..|..||...||      
  Fly   118 HHHHHLMGGFNPLTPPGLP-NPMQ----HFYGGNLRPSPQPTPTSASTIAPVAVATGSSEKLQAL 177

  Fly   283 ----------SGAKSGGGGSSAPSDDRSDRDNGSLYSGDEFSKDKKNSSLIREGDIDFTDDENGF 337
                      |.||      |:.|:...::::      |:.|...::...:.|.:   .||.|  
  Fly   178 TPPMDVTPPKSPAK------SSQSNIEPEKEH------DQMSNSSEDMKYMAESE---DDDTN-- 225

  Fly   338 DIRCEVCDKVYPDLDLLDDHLIGAHHFKQDEFPCKQCALRFCHRPLLIKHEAISHNNIRKYSCEN 402
             ||..:.:                                             ||..::.|.|:.
  Fly   226 -IRMPIYN---------------------------------------------SHGKMKNYKCKT 244

  Fly   403 CSKVFCDPSNLQRHIRAYHVGARCHPCPECGKTFGTSSGLKQHQHIHSSVKPFACEVCSKAYTQF 467
            |..|.....:...|.|.:....:...||:|.........|:.|...|.:.|||.|:.||......
  Fly   245 CGVVAITKVDFWAHTRTHMKPDKILQCPKCPFVTEFKHHLEYHIRKHKNQKPFQCDKCSYTCVNK 309

  Fly   468 SNLCRHKRMHATCRMQIKCDKCNQSFSTLTSLTKHKKFCDSTGPGPYRNQHVNRHHQHP----HQ 528
            |.|..|::.|::. .|.:|..|:  ::|        |:|.|.      ..|:.::...|    .:
  Fly   310 SMLNSHRKSHSSV-YQYRCADCD--YAT--------KYCHSF------KLHLRKYGHKPGMVLDE 357

  Fly   529 HPLPHQPHLAATATSTCPAP------PRESSESSSSAAAAAVAAM------STPPNPFLMFRTAP 581
            ...|: |.|......|...|      |..|..|.|.:..:.|||:      |.|..|....:.:.
  Fly   358 DGTPN-PSLVIDVYGTRRGPKSKNGGPIASGGSGSGSRKSNVAAVAPQQQQSQPAQPVATSQLSA 421

  Fly   582 SFFPGFP-------PYGFPPFLPQNPLHPTNIPMFFSKNPMDLGCGGPEITSP-------VSAFD 632
            : ..|||       |....|.||. |..|........:.        |.:.||       .|...
  Fly   422 A-LQGFPLVQGNSAPPAASPVLPL-PASPAKSVASVEQT--------PSLPSPANLLPPLASLLQ 476

  Fly   633 QKLPFGFLKGENSESQAYDKVTEKELVFKAEEKLKKEPLVQAFEGEEDESRSSLDIKGKLEDTRN 697
            |.....|....|...|......:..::.:...:::::...|                   ...::
  Fly   477 QNRNMAFFPYWNLNLQMLAAQQQAAVLAQLSPRMREQLQQQ-------------------NQQQS 522

  Fly   698 DSKSEEQDDMKQEPERVSTPDQQQAEDDRKSIDIMSTPPPADTPSGGDGPLDLSICRKRSAGSFF 762
            |::.|||||                |.:|||:               |..:||      |.|   
  Fly   523 DNEEEEQDD----------------EYERKSV---------------DSAMDL------SQG--- 547

  Fly   763 TAPAEDNLMLHRFMPRLHEFEAERGQPLKMRKSHSS----------------AESSTSQKSHKGS 811
            |...||........|.....:.|......|..|::|                :|:.||.:..|..
  Fly   548 TPVKEDEQQQQPQQPLAMNLKVEEEATPLMSSSNASRRKGRVLKLDTLLQLRSEAMTSPEQLKVP 612

  Fly   812 SPTPTPTAS---PGLTPSPSPPTSAGGELSSTSEGGAVP----TMAAAAFAADHSALASGPTLPQ 869
            | ||.||||   .|..|.|....|.......:.|...||    :.::.|.::.:|:.||.     
  Fly   613 S-TPMPTASSPIAGRKPMPEEHCSGTSSADESMETAHVPQANTSASSTASSSGNSSNASS----- 671

  Fly   870 THPTFHPLLLEEIYRSGFPFLCQPGGRRGIEALLAGAASA-AAPKRPLPPVKFSAGSVVGLKTKD 933
                                  ...|.....:...|..|| |||....|.   :||::       
  Fly   672 ----------------------NSNGNSSSNSSSNGTTSAVAAPPSGTPA---AAGAI------- 704

  Fly   934 RYSCKFCGKVFPRSANLTRHLRTHTGEQPYPCKYCDRAFSISSNLQRHV-RNIHN 987
             |.||:|...|..:...|.|:..|:.:..:.|..|.........|..|: ||.|:
  Fly   705 -YECKYCDIFFKDAVLYTIHMGYHSCDDVFKCNMCGEKCDGPVGLFVHMARNAHS 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hamNP_724130.4 PR-SET_ZFPM 131..253 CDD:380978 15/122 (12%)
C2H2 Zn finger 341..363 CDD:275368 0/21 (0%)
C2H2 Zn finger 371..392 CDD:275368 0/20 (0%)
SFP1 <391..479 CDD:227516 24/87 (28%)
C2H2 Zn finger 400..421 CDD:275368 5/20 (25%)
SUF4-like 403..>445 CDD:411020 8/41 (20%)
C2H2 Zn finger 403..421 CDD:411020 4/17 (24%)
C2H2 Zn finger 429..449 CDD:275368 5/19 (26%)
C2H2 Zn finger 457..477 CDD:275368 6/19 (32%)
C2H2 Zn finger 486..504 CDD:275368 3/17 (18%)
PTZ00121 <641..>728 CDD:173412 11/86 (13%)
COG5048 935..>1028 CDD:227381 15/54 (28%)
zf-C2H2 935..957 CDD:395048 7/21 (33%)
C2H2 Zn finger 937..957 CDD:275368 6/19 (32%)
zf-H2C2_2 949..973 CDD:404364 5/23 (22%)
C2H2 Zn finger 965..986 CDD:275368 6/21 (29%)
C2H2 Zn finger 994..1014 CDD:275368
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 5/19 (26%)
C2H2 Zn finger 271..291 CDD:275368 5/19 (26%)
zf-H2C2_2 283..308 CDD:290200 9/24 (38%)
C2H2 Zn finger 299..319 CDD:275368 6/19 (32%)
C2H2 Zn finger 327..345 CDD:275368 7/33 (21%)
C2H2 Zn finger 707..727 CDD:275371 6/19 (32%)
C2H2 Zn finger 735..757 CDD:275371 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.