DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ham and ZNF888

DIOPT Version :9

Sequence 1:NP_724130.4 Gene:ham / 35135 FlyBaseID:FBgn0045852 Length:1108 Species:Drosophila melanogaster
Sequence 2:XP_016882287.1 Gene:ZNF888 / 388559 HGNCID:38695 Length:830 Species:Homo sapiens


Alignment Length:722 Identity:161/722 - (22%)
Similarity:246/722 - (34%) Gaps:233/722 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 NSSLIREGDI-----DFTDDENGFDIRCEVCDKVYPDLDLLDDHLIGAHHFKQDEFPCKQCALRF 378
            :|.|.::.|:     .|..:|:|....|.         .|...|.|  .|..:.::.|..|...|
Human   310 SSLLTQKQDVHRKEKSFQFNESGKSFNCS---------SLFKKHQI--IHLGEKQYKCDVCGKDF 363

  Fly   379 CHRPLLIKHEAISHNNIRKYSCENCSKVFCDPSNLQRHIRAYHVGARCHPCPECGKTFGTSSGLK 443
            ..:..|..|.. .|...:.|.|..|.|||...:.|.||.|. |.|.:.:.|.||||||...|.|.
Human   364 NQKRYLAHHRR-CHTGEKPYMCNKCGKVFNKKAYLARHYRR-HTGEKPYKCNECGKTFSDKSALL 426

  Fly   444 QHQHIHSSVKPFACEVCSKAYTQFSNLCRHKRMHATCRMQIKCDKCNQSFSTLTSLTKHKKFCDS 508
            .|:.||:..||:.|..|.|.:.|.|||.||.|:| |.....:|.:|::.||..:.|.:|::.  .
Human   427 VHKTIHTGEKPYKCNECGKVFNQQSNLARHHRVH-TGEKPYQCKECDKVFSRKSYLERHRRI--H 488

  Fly   509 TGPGPYRNQHVN---RHHQHPHQHPLPHQPHLAATATSTCPAPPRESSESSSSAAAAAVAAMSTP 570
            ||..||:.:..:   ||..|..||.:.|        |...|....|..::....:|         
Human   489 TGEKPYKCKVCDKAFRHDSHLAQHIVIH--------TREKPYKCNECGKTFGENSA--------- 536

  Fly   571 PNPFLMFRTAPSFFPGFPPYGFPPFLPQNPLHPTNIPMFFSKNPMDLGCGGPEITSPVSAFDQKL 635
               .|:.:|                     :|....|...::      ||        ..|:|:.
Human   537 ---LLVHKT---------------------IHTGEKPYKCNE------CG--------KVFNQQS 563

  Fly   636 PFGFLKGENSESQAYDKVTEKELVFKAEEKLKKEPLVQAFEGEEDESRSSLDIKGKLEDTRNDSK 700
            ........::..:.| |..|.:.||..:..|::...:..  ||:       ..|.|:.|     |
Human   564 NLARHHRLHTGEKPY-KCKECDKVFSRKSHLERHRRIHT--GEK-------PYKCKVCD-----K 613

  Fly   701 SEEQDDMKQEPERVSTPDQQQAEDDRKSIDIMSTPPPADTPSGGDGPLDLSICRKRSAGSFFTAP 765
            :..:|....:...:.|                           |:.|...:.|.|       |..
Human   614 AFRRDSHLAQHTVIHT---------------------------GEKPYKCNECGK-------TFV 644

  Fly   766 AEDNLMLHRFMPRLHEFEAERGQPLKMRKSHSSAESSTSQKS-------HKGSSPTPTPTASPGL 823
            ...:|::|:.   :|..|       |..|.:...:|...:.|       |.|..|          
Human   645 QNSSLVMHKV---IHTGE-------KRYKCNECGKSFNHKSSLAYHHRLHTGEKP---------- 689

  Fly   824 TPSPSPPTSAGGELSSTSEGGAVPTMAAAAFAADHSALASGPTLPQTHPTFHPLLLEEIYRSGFP 888
                          ...:|.|.|  ....:..|.|..|.:|..                     |
Human   690 --------------YKCNECGKV--FRTQSQLACHHRLHTGEK---------------------P 717

  Fly   889 FLCQPGGRRGIEALLAGAASAAAPKRPLPPVKFSAGSVVGLKT-----------KDRYSCKFCGK 942
            :.|:                             ....|..:|:           :..|.|:.|.|
Human   718 YKCE-----------------------------ECDKVFNIKSHLEIHRRVHTGEKPYKCRVCDK 753

  Fly   943 VFPRSANLTRHLRTHTGEQPYPCKYCDRAFSISSNLQRHVRNIHNKERPFRCELCDRSFGQQTNL 1007
            .|.|.:.|.:|.|.||||:||.||.||:||...|:|.:|.| ||..|:||:|..|.::|..|:.|
Human   754 AFGRDSYLAQHQRVHTGEKPYKCKVCDKAFKCYSHLAQHTR-IHTGEKPFKCSECGKAFRAQSTL 817

  Fly  1008 DRHVKKH 1014
            ..|...|
Human   818 IHHQAIH 824

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hamNP_724130.4 PR-SET_ZFPM 131..253 CDD:380978
C2H2 Zn finger 341..363 CDD:275368 4/21 (19%)
C2H2 Zn finger 371..392 CDD:275368 5/20 (25%)
SFP1 <391..479 CDD:227516 38/87 (44%)
C2H2 Zn finger 400..421 CDD:275368 9/20 (45%)
SUF4-like 403..>445 CDD:411020 19/41 (46%)
C2H2 Zn finger 403..421 CDD:411020 8/17 (47%)
C2H2 Zn finger 429..449 CDD:275368 10/19 (53%)
C2H2 Zn finger 457..477 CDD:275368 10/19 (53%)
C2H2 Zn finger 486..504 CDD:275368 6/17 (35%)
PTZ00121 <641..>728 CDD:173412 14/86 (16%)
COG5048 935..>1028 CDD:227381 37/80 (46%)
zf-C2H2 935..957 CDD:395048 9/21 (43%)
C2H2 Zn finger 937..957 CDD:275368 8/19 (42%)
zf-H2C2_2 949..973 CDD:404364 14/23 (61%)
C2H2 Zn finger 965..986 CDD:275368 10/20 (50%)
C2H2 Zn finger 994..1014 CDD:275368 6/19 (32%)
ZNF888XP_016882287.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.