DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ham and ZIK1

DIOPT Version :9

Sequence 1:NP_724130.4 Gene:ham / 35135 FlyBaseID:FBgn0045852 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_001010879.2 Gene:ZIK1 / 284307 HGNCID:33104 Length:487 Species:Homo sapiens


Alignment Length:214 Identity:66/214 - (30%)
Similarity:98/214 - (45%) Gaps:16/214 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 CEVCDKVYPDLDLLDDHLIGAHHFKQDEFPCKQCALRFCHRPLLIKHEAISHNNIRKYSCENCSK 405
            |..|.|.:.....|:||  ...|..:..:.|.:|...|.....|:.|:.| |...|.|.|..|.|
Human   269 CNECGKFFSQTSHLNDH--RRIHTGERPYECSECGKLFRQNSSLVDHQKI-HTGARPYECSQCGK 330

  Fly   406 VFCDPSNLQRHIRAYHVGARCHPCPECGKTFGTSSGLKQHQHIHSSVKPFACEVCSKAYTQFSNL 470
            .|...:.|.:|.|. |.|.|.:.|.|||.:|..|:.|.||:.||:..||:.|..|.|:::|.:.|
Human   331 SFSQKATLVKHQRV-HTGERPYKCGECGNSFSQSAILNQHRRIHTGAKPYECGQCGKSFSQKATL 394

  Fly   471 CRHKRMHATCRMQIKCDKCNQSFSTLTSLTKHKKFCDSTGPGPYRNQHVNR---------HHQHP 526
            .:|:|:| |.....||..|.:|||..:.|.:|::.  .||..||......:         .||..
Human   395 IKHQRVH-TGERPYKCGDCGKSFSQSSILIQHRRI--HTGARPYECGQCGKSFSQKSGLIQHQVV 456

  Fly   527 HQHPLPHQPHLAATATSTC 545
            |....|::.:....:.|.|
Human   457 HTGERPYECNKCGNSFSQC 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hamNP_724130.4 PR-SET_ZFPM 131..253 CDD:380978
C2H2 Zn finger 341..363 CDD:275368 6/21 (29%)
C2H2 Zn finger 371..392 CDD:275368 6/20 (30%)
SFP1 <391..479 CDD:227516 34/87 (39%)
C2H2 Zn finger 400..421 CDD:275368 7/20 (35%)
SUF4-like 403..>445 CDD:411020 16/41 (39%)
C2H2 Zn finger 403..421 CDD:411020 6/17 (35%)
C2H2 Zn finger 429..449 CDD:275368 9/19 (47%)
C2H2 Zn finger 457..477 CDD:275368 7/19 (37%)
C2H2 Zn finger 486..504 CDD:275368 7/17 (41%)
PTZ00121 <641..>728 CDD:173412
COG5048 935..>1028 CDD:227381
zf-C2H2 935..957 CDD:395048
C2H2 Zn finger 937..957 CDD:275368
zf-H2C2_2 949..973 CDD:404364
C2H2 Zn finger 965..986 CDD:275368
C2H2 Zn finger 994..1014 CDD:275368
ZIK1NP_001010879.2 KRAB 27..>68 CDD:214630
KRAB 27..66 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..94
C2H2 Zn finger 215..233 CDD:275368
C2H2 Zn finger 241..261 CDD:275368
zf-H2C2_2 253..278 CDD:290200 3/8 (38%)
COG5048 <269..449 CDD:227381 60/186 (32%)
C2H2 Zn finger 269..289 CDD:275368 6/21 (29%)
zf-H2C2_2 281..306 CDD:290200 7/26 (27%)
C2H2 Zn finger 297..317 CDD:275368 6/20 (30%)
zf-H2C2_2 309..334 CDD:290200 10/25 (40%)
C2H2 Zn finger 325..345 CDD:275368 7/20 (35%)
zf-H2C2_2 338..362 CDD:290200 11/24 (46%)
C2H2 Zn finger 353..373 CDD:275368 9/19 (47%)
zf-H2C2_2 366..390 CDD:290200 10/23 (43%)
C2H2 Zn finger 381..401 CDD:275368 7/19 (37%)
zf-H2C2_2 394..418 CDD:290200 10/24 (42%)
C2H2 Zn finger 409..429 CDD:275368 7/21 (33%)
zf-H2C2_2 422..446 CDD:290200 6/25 (24%)
C2H2 Zn finger 437..457 CDD:275368 2/19 (11%)
C2H2 Zn finger 465..485 CDD:275368 2/11 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.