DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ham and sfc2

DIOPT Version :9

Sequence 1:NP_724130.4 Gene:ham / 35135 FlyBaseID:FBgn0045852 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_594670.1 Gene:sfc2 / 2542887 PomBaseID:SPAC144.09c Length:374 Species:Schizosaccharomyces pombe


Alignment Length:195 Identity:61/195 - (31%)
Similarity:86/195 - (44%) Gaps:20/195 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 EVCDKVYPDLDLLDDHLIGAHHFKQDEFPC--KQCALRFCHRPLLIKHEAISHNNIRKYSC--EN 402
            |.||:.:.....|..| |.|.|.....:||  :.|.|||..:..|..|...:|..|..|||  |:
pombe   118 EGCDECFSKHQQLRSH-ISACHTHLLPYPCTYQDCELRFATKQKLQNHVNRAHEKIISYSCPHES 181

  Fly   403 C--SKVFCDPSNLQRHIRAYHVGARCHPCPECGKTFGTSSGLKQHQHIHSSV----KPFAC--EV 459
            |  .:.|...|.||.|||..||.:    |..||:.|.|::.|:.|..:|.:.    |.:.|  |.
pombe   182 CVGHEGFEKWSQLQNHIREAHVPS----CSICGRQFKTAAHLRHHVVLHQTTLEERKTYHCPMEG 242

  Fly   460 CSKAYTQFSNLCRHKRMHATCRMQIKCDKCNQSFSTLTSLTKH--KKFCDSTGPGPYRNQHVNRH 522
            |.|::|:.|.|.:|..:.....|...||.|...|.....|.:|  :..|..... ||.|:...:|
pombe   243 CKKSFTRSSALKKHISVIHEGNMAFHCDSCGTKFGYKHMLQRHLERGTCKKAHK-PYINECGIKH 306

  Fly   523  522
            pombe   307  306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hamNP_724130.4 PR-SET_ZFPM 131..253 CDD:380978
C2H2 Zn finger 341..363 CDD:275368 7/20 (35%)
C2H2 Zn finger 371..392 CDD:275368 7/22 (32%)
SFP1 <391..479 CDD:227516 33/97 (34%)
C2H2 Zn finger 400..421 CDD:275368 10/24 (42%)
SUF4-like 403..>445 CDD:411020 16/43 (37%)
C2H2 Zn finger 403..421 CDD:411020 8/19 (42%)
C2H2 Zn finger 429..449 CDD:275368 7/19 (37%)
C2H2 Zn finger 457..477 CDD:275368 8/21 (38%)
C2H2 Zn finger 486..504 CDD:275368 6/19 (32%)
PTZ00121 <641..>728 CDD:173412
COG5048 935..>1028 CDD:227381
zf-C2H2 935..957 CDD:395048
C2H2 Zn finger 937..957 CDD:275368
zf-H2C2_2 949..973 CDD:404364
C2H2 Zn finger 965..986 CDD:275368
C2H2 Zn finger 994..1014 CDD:275368
sfc2NP_594670.1 COG5048 1..374 CDD:227381 61/195 (31%)
C2H2 Zn finger 28..47 CDD:275368
C2H2 Zn finger 55..77 CDD:275368
C2H2 Zn finger 85..107 CDD:275368
C2H2 Zn finger 115..138 CDD:275368 7/20 (35%)
C2H2 Zn finger 146..165 CDD:275368 6/18 (33%)
C2H2 Zn finger 206..226 CDD:275368 7/19 (37%)
C2H2 Zn finger 238..261 CDD:275368 8/22 (36%)
C2H2 Zn finger 269..286 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.