DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ham and ZNF540

DIOPT Version :9

Sequence 1:NP_724130.4 Gene:ham / 35135 FlyBaseID:FBgn0045852 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_001165696.1 Gene:ZNF540 / 163255 HGNCID:25331 Length:660 Species:Homo sapiens


Alignment Length:761 Identity:159/761 - (20%)
Similarity:236/761 - (31%) Gaps:300/761 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 SDRDNGSLYSGDEFSKDKK--NSSLIREGDID--------------------------FTDDENG 336
            :||...|..........:|  :|.|::.|.||                          .|.::: 
Human   151 TDRKRPSFTLNQRIHNSEKSCDSHLVQHGKIDSDVKHDCKECGSTFNNVYQLTLHQKIHTGEKS- 214

  Fly   337 FDIRCEVCDKVYPDLDLLDDHLIGAHHFKQDEFPCKQCALRFCHRPLLIKHEAISHNNIRKYSCE 401
              .:||.|.||:.....|..|  ...|..:..:.|::|...|...|.|.:|:.| |...:.|.|:
Human   215 --CKCEKCGKVFSHSYQLTLH--QRFHTGEKPYECQECGKTFTLYPQLNRHQKI-HTGKKPYMCK 274

  Fly   402 NCSKVFCDPSNLQRHIRAYHVGARCHPCPECGKTFGTSSGLKQHQHIHSSVKPFACEVCSKAYTQ 466
            .|.|.|.....|.:|.| .|.|.:.:.|.||||.|......|:|:.||:..||:.|:.|.||::.
Human   275 KCDKGFFSRLELTQHKR-IHTGKKSYECKECGKVFQLIFYFKEHERIHTGKKPYECKECGKAFSV 338

  Fly   467 FSNLCRHKRMHATCRMQIKCDKCNQSFSTLTSLTKHKKFCDSTGPGPY-----------RNQHVN 520
            ...|.||:::|...: ..:|.:|.::|.....||:|::  ...|..||           |.| :|
Human   339 CGQLTRHQKIHTGVK-PYECKECGKTFRLSFYLTEHRR--THAGKKPYECKECGKSFNVRGQ-LN 399

  Fly   521 RHHQ-HPHQHPLPHQPHLAATATSTCPAPPRESSESSSSAAAAAVAAMSTPPNPFLMFRTAPSFF 584
            ||.. |....|.         |...|     |.:.|.|..                 .|......
Human   400 RHKTIHTGIKPF---------ACKVC-----EKAFSYSGD-----------------LRVHSRIH 433

  Fly   585 PGFPPYGFPPFLPQNPLHPTNIPMFFSKNPMDLGCGGPEITSPVSAFDQKLPFGFLKGENSESQA 649
            .|..||....                        ||...:...|....|:|..|....|..|.  
Human   434 TGEKPYECKE------------------------CGKAFMLRSVLTEHQRLHTGVKPYECKEC-- 472

  Fly   650 YDKVTEKELVFKAEEKLKKEPLVQAFEGEEDESRSSLDIKGKLEDTRNDSKSEEQDDMKQEPERV 714
                                       |:....||.:.:..|:           ..|:|      
Human   473 ---------------------------GKTFRVRSQISLHKKI-----------HTDVK------ 493

  Fly   715 STPDQQQAEDDRKSIDIMSTPPPADTPSGGDGPLDLSICRKRSAGSFFTAPAEDNLMLHRFMPRL 779
                                            |.....|.|.....|:       |..|:   |:
Human   494 --------------------------------PYKCVRCGKTFRFGFY-------LTEHQ---RI 516

  Fly   780 HEFEAERGQPLKMRKSHSSAESSTSQKSHKGSSPTPTPTASPGLTPSPSPPTSAGGELSSTSEGG 844
            |..|    :|.|.::...:.....:.|.|                                    
Human   517 HTGE----KPYKCKECGKAFIRRGNLKEH------------------------------------ 541

  Fly   845 AVPTMAAAAFAADHSALASGPTLPQTHPTFHPLLLEEIYRSGFPFLCQPGG----RRGIEALLAG 905
                      ...||.|.                         |:.|:..|    |||       
Human   542 ----------LKIHSGLK-------------------------PYDCKECGKSFSRRG------- 564

  Fly   906 AASAAAPKRPLPPVKFSAGSVV--GLKTKDRYSCKFCGKVFPRSANLTRHLRTHTGEQPYPCKYC 968
                          :|:....:  |:|.   |.||.|||.|.||.:|..|.|.||||:||.||.|
Human   565 --------------QFTEHQKIHTGVKP---YKCKECGKAFSRSVDLRIHQRIHTGEKPYECKQC 612

  Fly   969 DRAFSISSNLQRHVRNIHNKERPFRCELCDRSFGQQTNLDRHVKKH 1014
            .:||.::|:|..|.| ||..|:|:.|::|.::|.|.::|.:|.|.|
Human   613 GKAFRLNSHLTEHQR-IHTGEKPYECKVCRKAFRQYSHLYQHQKTH 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hamNP_724130.4 PR-SET_ZFPM 131..253 CDD:380978
C2H2 Zn finger 341..363 CDD:275368 7/21 (33%)
C2H2 Zn finger 371..392 CDD:275368 7/20 (35%)
SFP1 <391..479 CDD:227516 31/87 (36%)
C2H2 Zn finger 400..421 CDD:275368 7/20 (35%)
SUF4-like 403..>445 CDD:411020 15/41 (37%)
C2H2 Zn finger 403..421 CDD:411020 6/17 (35%)
C2H2 Zn finger 429..449 CDD:275368 8/19 (42%)
C2H2 Zn finger 457..477 CDD:275368 7/19 (37%)
C2H2 Zn finger 486..504 CDD:275368 6/17 (35%)
PTZ00121 <641..>728 CDD:173412 8/86 (9%)
COG5048 935..>1028 CDD:227381 39/80 (49%)
zf-C2H2 935..957 CDD:395048 12/21 (57%)
C2H2 Zn finger 937..957 CDD:275368 11/19 (58%)
zf-H2C2_2 949..973 CDD:404364 13/23 (57%)
C2H2 Zn finger 965..986 CDD:275368 9/20 (45%)
C2H2 Zn finger 994..1014 CDD:275368 7/19 (37%)
ZNF540NP_001165696.1 KRAB 6..66 CDD:214630
C2H2 Zn finger 189..209 CDD:275368 0/19 (0%)
C2H2 Zn finger 217..237 CDD:275368 7/21 (33%)
COG5048 241..620 CDD:227381 125/626 (20%)
C2H2 Zn finger 245..265 CDD:275368 7/20 (35%)
C2H2 Zn finger 273..293 CDD:275368 7/20 (35%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
C2H2 Zn finger 329..349 CDD:275368 7/19 (37%)
C2H2 Zn finger 357..377 CDD:275368 6/21 (29%)
C2H2 Zn finger 385..405 CDD:275368 5/20 (25%)
C2H2 Zn finger 413..433 CDD:275368 5/41 (12%)
C2H2 Zn finger 441..461 CDD:275368 4/43 (9%)
C2H2 Zn finger 469..489 CDD:275368 5/59 (8%)
C2H2 Zn finger 497..517 CDD:275368 6/29 (21%)
C2H2 Zn finger 525..545 CDD:275368 2/65 (3%)
C2H2 Zn finger 553..573 CDD:275368 6/40 (15%)
C2H2 Zn finger 581..601 CDD:275368 11/19 (58%)
C2H2 Zn finger 609..629 CDD:275368 9/20 (45%)
zf-H2C2_2 621..646 CDD:316026 10/25 (40%)
C2H2 Zn finger 637..657 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.