DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ham and ZNF100

DIOPT Version :9

Sequence 1:NP_724130.4 Gene:ham / 35135 FlyBaseID:FBgn0045852 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_775802.2 Gene:ZNF100 / 163227 HGNCID:12880 Length:542 Species:Homo sapiens


Alignment Length:748 Identity:143/748 - (19%)
Similarity:209/748 - (27%) Gaps:365/748 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 DNGSLYSG----DEFSKDKKNSSLIREGDIDFTDDENGFDIRCEVCDKVYPDLDLLDDHLIGAHH 363
            ||..|..|    ||....|::.:.:.:..|  |...|.|  :|:...||:......:.|.|  .|
Human   141 DNLQLQKGCKSVDECKVHKEHDNKLNQCLI--TTQSNIF--QCDPSAKVFHTFSNSNRHKI--RH 199

  Fly   364 FKQDEFPCKQCALRFCHRPLLIKHEAISHNNIRKYSCENCSKVFCDPSNLQRHIRAYHVGARCHP 428
            .::..|.||:|...||....|.:|:.. |.....|.|::|.|.|...|.|..| |..|.|.:.:.
Human   200 TRKKPFKCKKCEKSFCMLLHLTQHKRF-HITENSYQCKDCGKAFNWFSTLTTH-RRIHTGEKPYK 262

  Fly   429 CPECGKTFGTSSGLKQHQHIHSSVKPFACEVCSKAYTQFSNLCRHKRMHATCRMQIKCDKCNQSF 493
            |.||||.|..||.|..|:.||:..||:.||.|.||:.:.|:|..|||:|...: ..||.:|.::|
Human   263 CEECGKAFNRSSHLTTHKIIHTGEKPYRCEECGKAFNRSSHLTTHKRIHTGVK-PYKCTECGKAF 326

  Fly   494 STLTSLTKHKKFCDSTGPGPYRNQHVNRHHQHPHQHPLPHQPHLAATATSTCPAPPRESSESSSS 558
            :..:.||.|:..  .||..||:.:.                                        
Human   327 NRSSHLTTHRII--HTGEKPYKCEE---------------------------------------- 349

  Fly   559 AAAAAVAAMSTPPNPFLMFRTAPSFFPGFPPYGFPPFLPQNPLHPTNIPMFFSKNPMDLGCGGPE 623
                                                                        ||   
Human   350 ------------------------------------------------------------CG--- 351

  Fly   624 ITSPVSAFDQKLPFGFLKGENSESQAYDKVTEK-ELVFKAEEKLKKEPLVQAFEGEEDESRSSLD 687
                 .||:|           |.:....|:|.. |..:|.||                       
Human   352 -----KAFNQ-----------SSTLTTHKITHAGEKPYKCEE----------------------- 377

  Fly   688 IKGKLEDTRNDSKSEEQDDMKQEPERVSTPDQQQAEDDRKSIDIMSTPPPADTPSGGDGPLDLSI 752
                                                                             
Human   378 ----------------------------------------------------------------- 377

  Fly   753 CRKRSAGSFFTAPAEDNLMLHRFMPRLHEFEAERGQPLKMRKSHSSAESSTSQKSHKGSSPTPTP 817
            |.|               ..:||           ....|.:.||:..:....::..||.:     
Human   378 CGK---------------AFYRF-----------SYLTKHKTSHTGEKFYKCEECGKGFN----- 411

  Fly   818 TASPGLTPSPSPPTSAGGELSSTSEGGAVPTMAAAAFAADHSALASGPTLPQTHPTFHPLLLEEI 882
             .|..||                                .|..:.:|                  
Human   412 -WSSALT--------------------------------KHKRIHTG------------------ 425

  Fly   883 YRSGFPFLCQPGGRRGIEALLAGAASAAAPKRPLPPVKFSAGSVVGLKTKDRYSCKFCGKVFPRS 947
                                          ::|                   |.|:.|||.|..|
Human   426 ------------------------------EKP-------------------YKCEECGKAFNES 441

  Fly   948 ANLTRHLRTHTGEQPYPCKYCDRAFSISSNLQRHVRNIHNKERPFRCELCDRSFGQQTNLDRHVK 1012
            :|||.|...||||:||.|..|.:||:.||.|..| :.||..|:|::||.|.::|.:.:.|.:|..
Human   442 SNLTTHKMIHTGEKPYKCDECGKAFNRSSQLTAH-KMIHTGEKPYKCEECGKAFNRSSTLTKHKI 505

  Fly  1013 KHESE--------GNNFRDSPSSSGIAEREEYF 1037
            .|..|        |.:|..|.|.  |.:...|:
Human   506 THTGEKSYKWEECGKDFNQSLSL--IKQNNSYW 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hamNP_724130.4 PR-SET_ZFPM 131..253 CDD:380978
C2H2 Zn finger 341..363 CDD:275368 5/21 (24%)
C2H2 Zn finger 371..392 CDD:275368 7/20 (35%)
SFP1 <391..479 CDD:227516 37/87 (43%)
C2H2 Zn finger 400..421 CDD:275368 8/20 (40%)
SUF4-like 403..>445 CDD:411020 18/41 (44%)
C2H2 Zn finger 403..421 CDD:411020 7/17 (41%)
C2H2 Zn finger 429..449 CDD:275368 10/19 (53%)
C2H2 Zn finger 457..477 CDD:275368 10/19 (53%)
C2H2 Zn finger 486..504 CDD:275368 6/17 (35%)
PTZ00121 <641..>728 CDD:173412 7/87 (8%)
COG5048 935..>1028 CDD:227381 41/100 (41%)
zf-C2H2 935..957 CDD:395048 11/21 (52%)
C2H2 Zn finger 937..957 CDD:275368 10/19 (53%)
zf-H2C2_2 949..973 CDD:404364 13/23 (57%)
C2H2 Zn finger 965..986 CDD:275368 8/20 (40%)
C2H2 Zn finger 994..1014 CDD:275368 6/19 (32%)
ZNF100NP_775802.2 KRAB 35..96 CDD:214630
KRAB 35..74 CDD:279668
COG5048 150..534 CDD:227381 138/735 (19%)
C2H2 Zn finger 207..227 CDD:275368 7/20 (35%)
C2H2 Zn finger 235..255 CDD:275368 8/20 (40%)
zf-H2C2_2 248..272 CDD:290200 11/24 (46%)
C2H2 Zn finger 263..283 CDD:275368 10/19 (53%)
zf-H2C2_2 275..300 CDD:290200 11/24 (46%)
C2H2 Zn finger 291..311 CDD:275368 10/19 (53%)
zf-H2C2_2 303..328 CDD:290200 9/25 (36%)
C2H2 Zn finger 319..339 CDD:275368 6/21 (29%)
zf-H2C2_2 331..356 CDD:290200 11/134 (8%)
C2H2 Zn finger 347..367 CDD:275368 7/138 (5%)
C2H2 Zn finger 375..395 CDD:275368 7/133 (5%)
C2H2 Zn finger 403..423 CDD:275368 6/57 (11%)
zf-H2C2_2 415..439 CDD:290200 10/122 (8%)
C2H2 Zn finger 431..451 CDD:275368 10/19 (53%)
zf-H2C2_2 443..468 CDD:290200 14/24 (58%)
C2H2 Zn finger 459..479 CDD:275368 8/20 (40%)
zf-H2C2_2 472..496 CDD:290200 10/24 (42%)
C2H2 Zn finger 487..507 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.