DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ham and ZNF569

DIOPT Version :9

Sequence 1:NP_724130.4 Gene:ham / 35135 FlyBaseID:FBgn0045852 Length:1108 Species:Drosophila melanogaster
Sequence 2:XP_006723109.1 Gene:ZNF569 / 148266 HGNCID:24737 Length:710 Species:Homo sapiens


Alignment Length:766 Identity:177/766 - (23%)
Similarity:259/766 - (33%) Gaps:277/766 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 SDDRSDRDNGSLYSGDEFSK------DKKNS--SLIREGDIDFTDDENGF----------DIRCE 342
            ||....|.|  ||..|.|.|      |..|:  .|:|:...::.:....:          ..:|.
Human   151 SDFFPSRHN--LYEYDLFGKCLEHNFDCHNNVKCLMRKEHCEYNEPVKSYGNSSSHFVITPFKCN 213

  Fly   343 VCDKVY-PDLDLLDDHLIGAHHFKQDEFPCKQCALRFCHRPLLIKHEAISHNNIRKYSCENCSKV 406
            .|.|.: ..|||: .||  ..|..:..:.|..|...|.|:..||||..| |:..:.|.|..|.|.
Human   214 HCGKGFNQTLDLI-RHL--RIHTGEKPYECSNCRKAFSHKEKLIKHYKI-HSREQSYKCNECGKA 274

  Fly   407 FCDPSNLQRHIRAYHVGARCHPCPECGKTFGTSSGLKQHQHIHSSVKPFACEVCSKAYTQFSNLC 471
            |...|||.||.| .|.|.:.:.|.||.|:|...|.|..|:.||:..||:.|..|.||::|..:|.
Human   275 FIKMSNLIRHQR-IHTGEKPYACKECEKSFSQKSNLIDHEKIHTGEKPYECNECGKAFSQKQSLI 338

  Fly   472 RHKRMHATCRMQIKCDKCNQSFSTLTSLTKHKKFCDSTGPGPYRNQ--------------HVNRH 522
            .|:::| |......|::|.::|..:.||..|.:  ..||..||:..              ||..|
Human   339 AHQKVH-TGEKPYACNECGKAFPRIASLALHMR--SHTGEKPYKCDKCGKAFSQFSMLIIHVRIH 400

  Fly   523 HQHPHQHPLPHQPHLAATATSTCPAPPRESSESSSSAAAAAVAAMSTPPNPFLMFRTAPSFFPGF 587
                               |...|....|..::.|.::|..|...|               ..|.
Human   401 -------------------TGEKPYECNECGKAFSQSSALTVHMRS---------------HTGE 431

  Fly   588 PPYGFPPFLPQNPLHPTNIPMFFSKNPMDLGCGGPEITSPVSAFDQKLPFGFLKGENSESQAYDK 652
            .||                                |......||..|..|          ..:.|
Human   432 KPY--------------------------------ECKECRKAFSHKKNF----------ITHQK 454

  Fly   653 VTEKELVFKAEEKLKKEPLVQAFEGEEDESRSSLDIKGKLEDTRNDSKSEEQDDMKQEPERVSTP 717
            :..:|..::..|.           |:.....|:|        .|:              :|:.| 
Human   455 IHTREKPYECNEC-----------GKAFIQMSNL--------VRH--------------QRIHT- 485

  Fly   718 DQQQAEDDRKSIDIMSTPPPADTPSGGDGPLDLSICRKRSAGSFFTAPAEDNLMLHRFMPRLHEF 782
                                      |:.|.   ||::  .|..|:  .:.||:.|.   ::|..
Human   486 --------------------------GEKPY---ICKE--CGKAFS--QKSNLIAHE---KIHSG 514

  Fly   783 EA-----ERGQPLKMRKSHSSAESSTSQKSHKGSSPTPTPTASPGLTPSPSPPTSAGGELSSTSE 842
            |.     |.|:....:::.     .|.||.|.|..|                        ...:|
Human   515 EKPYECNECGKAFSQKQNF-----ITHQKVHTGEKP------------------------YDCNE 550

  Fly   843 GGAVPTMAAAAFAADHSALASGPTLPQTHPTFHPLLLEEIYRSG-FPFLCQPGGRRGIEALLAGA 906
            .|       .||    |.:||             |.|.....:| .|:.|...|:          
Human   551 CG-------KAF----SQIAS-------------LTLHLRSHTGEKPYECDKCGK---------- 581

  Fly   907 ASAAAPKRPLPPVKFSAGSVVGLKTKDR-----YSCKFCGKVFPRSANLTRHLRTHTGEQPYPCK 966
                         .||..|::.|..:..     |.|..|||.|.:..:|..|:|.||||:||.|.
Human   582 -------------AFSQCSLLNLHMRSHTGEKPYVCNECGKAFSQRTSLIVHMRGHTGEKPYECN 633

  Fly   967 YCDRAFSISSNLQRHVRNIHNKERPFRCELCDRSFGQQTNLDRHVKKHESE 1017
            .|.:|||.||:|..|:|. |..|:||.|..|.::|.|.::|..|::||..|
Human   634 KCGKAFSQSSSLTIHIRG-HTGEKPFDCSKCGKAFSQISSLTLHMRKHTGE 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hamNP_724130.4 PR-SET_ZFPM 131..253 CDD:380978
C2H2 Zn finger 341..363 CDD:275368 8/22 (36%)
C2H2 Zn finger 371..392 CDD:275368 9/20 (45%)
SFP1 <391..479 CDD:227516 34/87 (39%)
C2H2 Zn finger 400..421 CDD:275368 10/20 (50%)
SUF4-like 403..>445 CDD:411020 18/41 (44%)
C2H2 Zn finger 403..421 CDD:411020 9/17 (53%)
C2H2 Zn finger 429..449 CDD:275368 8/19 (42%)
C2H2 Zn finger 457..477 CDD:275368 7/19 (37%)
C2H2 Zn finger 486..504 CDD:275368 6/17 (35%)
PTZ00121 <641..>728 CDD:173412 9/86 (10%)
COG5048 935..>1028 CDD:227381 38/83 (46%)
zf-C2H2 935..957 CDD:395048 9/21 (43%)
C2H2 Zn finger 937..957 CDD:275368 8/19 (42%)
zf-H2C2_2 949..973 CDD:404364 12/23 (52%)
C2H2 Zn finger 965..986 CDD:275368 10/20 (50%)
C2H2 Zn finger 994..1014 CDD:275368 6/19 (32%)
ZNF569XP_006723109.1 KRAB 32..86 CDD:214630
COG5048 <200..368 CDD:227381 58/173 (34%)
C2H2 Zn finger 212..232 CDD:275368 8/22 (36%)
C2H2 Zn finger 240..260 CDD:275368 9/20 (45%)
C2H2 Zn finger 268..288 CDD:275368 10/20 (50%)
COG5048 292..704 CDD:227381 132/618 (21%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..372 CDD:275368 6/21 (29%)
C2H2 Zn finger 380..400 CDD:275368 2/19 (11%)
C2H2 Zn finger 408..428 CDD:275368 5/34 (15%)
C2H2 Zn finger 436..456 CDD:275368 5/29 (17%)
C2H2 Zn finger 464..484 CDD:275368 6/52 (12%)
C2H2 Zn finger 492..512 CDD:275368 6/26 (23%)
C2H2 Zn finger 520..540 CDD:275368 5/24 (21%)
C2H2 Zn finger 548..568 CDD:275368 9/43 (21%)
C2H2 Zn finger 576..596 CDD:275368 6/42 (14%)
C2H2 Zn finger 604..624 CDD:275368 8/19 (42%)
C2H2 Zn finger 632..652 CDD:275368 10/20 (50%)
C2H2 Zn finger 660..680 CDD:275368 6/19 (32%)
C2H2 Zn finger 688..708 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.