DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ham and ZNF98

DIOPT Version :9

Sequence 1:NP_724130.4 Gene:ham / 35135 FlyBaseID:FBgn0045852 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_001092096.1 Gene:ZNF98 / 148198 HGNCID:13174 Length:572 Species:Homo sapiens


Alignment Length:699 Identity:146/699 - (20%)
Similarity:222/699 - (31%) Gaps:303/699 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 KVYPDLDLLDDHLIGAHHFKQDEFPCKQCALRFCHRPLLIKHEAISHNNIRKYSCENCSKVFCDP 410
            ||:......:.|.||  |..:..|.||:|...||....|.:|:.| |:..:.|.|:.|.|.:.:.
Human   161 KVFHKFSNSNRHKIG--HTGKKSFKCKECEKSFCMLSHLAQHKRI-HSGEKPYKCKECGKAYNEA 222

  Fly   411 SNLQRHIRAYHVGARCHPCPECGKTFGTSSGLKQHQHIHSSVKPFACEVCSKAYTQFSNLCRHKR 475
            |||..|.| .|.|.:.:.|.||||.|...|.|..|:.||:..||:.||.|.||:.|.:||..|||
Human   223 SNLSTHKR-IHTGKKPYKCEECGKAFNRLSHLTTHKIIHTGKKPYKCEECGKAFNQSANLTTHKR 286

  Fly   476 MHATCRMQIKCDKCNQSFSTLTSLTKHKKFCDSTGPGPYRNQHVNRHHQHPHQHPLPHQPHLAAT 540
            :| |.....||::|.::||..::||.||..  ..|..||:.:.                      
Human   287 IH-TGEKPYKCEECGRAFSQSSTLTAHKII--HAGEKPYKCEE---------------------- 326

  Fly   541 ATSTCPAPPRESSESSSSAAAAAVAAMSTPPNPFLMFRTAPSFFPGFPPYGFPPFLPQNPLHPTN 605
                                                                             
Human   327 ----------------------------------------------------------------- 326

  Fly   606 IPMFFSKNPMDLGCGGPEITSPVSAFDQKLPFGFLKGENSESQAYDKVTEKELVFKAEEKLKKEP 670
                         ||        .||.|.                ..:|..:::...|:..|.|.
Human   327 -------------CG--------KAFSQS----------------STLTTHKIIHTGEKFYKCEE 354

  Fly   671 LVQAFEGEEDESRSSLDIKGKLEDTRNDSKSEEQDDMKQEPERVSTPDQQQAEDDRKSIDIMSTP 735
            ..:||      ||.|                                                  
Human   355 CGKAF------SRLS-------------------------------------------------- 363

  Fly   736 PPADTPSGGDGPLDLSICRKRSAGSFFTAPAEDNLMLHRFMPRLHEFEAERGQPLKMRKSHSSAE 800
                                             :|..|:   |:|..|    :|.|..:...:.:
Human   364 ---------------------------------HLTTHK---RIHSGE----KPYKCEECGKAFK 388

  Fly   801 SSTSQKSHKGSSPTPTPTASPGLTPSPSPPTSAGGELSSTSEGGAVPTMAAAAFAADHSALASGP 865
            .|::..:||                     ....||.....|   |.:.|.:.|           
Human   389 QSSTLTTHK---------------------RIHAGEKFYKCE---VCSKAFSRF----------- 418

  Fly   866 TLPQTHPTFHPLLLEEIYRSGFPFLCQPGGRR-GIEALLAGAASAAAPKRPLPPVKFSAGSVVGL 929
                :|.|.|    :.|:....|:.|:..|:. .:.:.|.........::|              
Human   419 ----SHLTTH----KRIHTGEKPYKCEECGKAFNLSSQLTTHKIIHTGEKP-------------- 461

  Fly   930 KTKDRYSCKFCGKVFPRSANLTRHLRTHTGEQPYPCKYCDRAFSISSNLQRHVRNIHNKERPFRC 994
                 |.|:.|||.|.:|:.|::|...||||:||.|:.|.:||:.||:|..| :.||..|:|::|
Human   462 -----YKCEECGKAFNQSSTLSKHKVIHTGEKPYKCEECGKAFNQSSHLTTH-KMIHTGEKPYKC 520

  Fly   995 ELCDRSFGQQTNLDRHVKKHESEG-------NNFRDSPSSSGIAEREEY 1036
            |.|.::|...:.|:||...|..|.       ||..|:     ||:..:|
Human   521 EECGKAFNNSSILNRHKMIHTGEKLYKPESCNNACDN-----IAKISKY 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hamNP_724130.4 PR-SET_ZFPM 131..253 CDD:380978
C2H2 Zn finger 341..363 CDD:275368 5/16 (31%)
C2H2 Zn finger 371..392 CDD:275368 8/20 (40%)
SFP1 <391..479 CDD:227516 37/87 (43%)
C2H2 Zn finger 400..421 CDD:275368 8/20 (40%)
SUF4-like 403..>445 CDD:411020 17/41 (41%)
C2H2 Zn finger 403..421 CDD:411020 7/17 (41%)
C2H2 Zn finger 429..449 CDD:275368 9/19 (47%)
C2H2 Zn finger 457..477 CDD:275368 11/19 (58%)
C2H2 Zn finger 486..504 CDD:275368 7/17 (41%)
PTZ00121 <641..>728 CDD:173412 9/86 (10%)
COG5048 935..>1028 CDD:227381 39/99 (39%)
zf-C2H2 935..957 CDD:395048 9/21 (43%)
C2H2 Zn finger 937..957 CDD:275368 8/19 (42%)
zf-H2C2_2 949..973 CDD:404364 11/23 (48%)
C2H2 Zn finger 965..986 CDD:275368 8/20 (40%)
C2H2 Zn finger 994..1014 CDD:275368 7/19 (37%)
ZNF98NP_001092096.1 KRAB 13..73 CDD:214630
KRAB 13..52 CDD:279668
COG5048 179..563 CDD:227381 139/676 (21%)
C2H2 Zn finger 184..204 CDD:275368 8/20 (40%)
zf-H2C2_2 196..220 CDD:290200 8/24 (33%)
C2H2 Zn finger 212..232 CDD:275368 8/20 (40%)
zf-H2C2_2 224..249 CDD:290200 12/25 (48%)
C2H2 Zn finger 240..260 CDD:275368 9/19 (47%)
zf-H2C2_2 252..277 CDD:290200 11/24 (46%)
C2H2 Zn finger 268..288 CDD:275368 11/19 (58%)
zf-H2C2_2 280..305 CDD:290200 11/25 (44%)
C2H2 Zn finger 296..316 CDD:275368 8/21 (38%)
C2H2 Zn finger 324..344 CDD:275368 6/143 (4%)
zf-H2C2_2 337..361 CDD:290200 6/29 (21%)
zf-C2H2 350..372 CDD:278523 10/113 (9%)
C2H2 Zn finger 352..372 CDD:275368 9/111 (8%)
zf-H2C2_2 364..389 CDD:290200 7/31 (23%)
C2H2 Zn finger 380..400 CDD:275368 3/40 (8%)
C2H2 Zn finger 408..428 CDD:275368 7/41 (17%)
zf-H2C2_2 420..444 CDD:290200 7/27 (26%)
C2H2 Zn finger 436..456 CDD:275368 3/19 (16%)
zf-H2C2_2 449..473 CDD:290200 8/42 (19%)
C2H2 Zn finger 464..484 CDD:275368 8/19 (42%)
zf-H2C2_2 477..501 CDD:290200 12/23 (52%)
C2H2 Zn finger 492..512 CDD:275368 8/20 (40%)
zf-H2C2_2 504..529 CDD:290200 10/25 (40%)
C2H2 Zn finger 520..540 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.