DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ham and Gm32687

DIOPT Version :9

Sequence 1:NP_724130.4 Gene:ham / 35135 FlyBaseID:FBgn0045852 Length:1108 Species:Drosophila melanogaster
Sequence 2:XP_011241923.1 Gene:Gm32687 / 102635315 MGIID:5591846 Length:619 Species:Mus musculus


Alignment Length:723 Identity:169/723 - (23%)
Similarity:238/723 - (32%) Gaps:261/723 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 RCEVCDKVYPDLDLLDDHLIGAHHFKQDEFPCKQCALRFCHRPLLIKHEAISHNNIRKYSCENCS 404
            ||..|.|.:.:...|..|  ..:|.::..:.|.||:..|..|..|..||. :|...:.|.|..|.
Mouse   126 RCSQCSKAFANFRSLRKH--EKNHTREKPYECSQCSKAFVSRSSLQIHER-THTREKLYDCNECG 187

  Fly   405 KVFCDPSNLQRHIRAYHVGARCHPCPECGKTFGTSSGLKQHQHIHSSVKPFACEVCSKAYTQFSN 469
            |.|...|:||.|.|. |.|.:.:.|.||||.|..||.|..|:..|:..||:.|..|.||:...|:
Mouse   188 KAFSTRSHLQIHKRT-HTGEKPYDCSECGKAFARSSTLLIHKRSHTGEKPYGCNECGKAFACRSH 251

  Fly   470 LCRHKRMHATCRMQIKCDKCNQSFSTLTSLTKHKKFCDSTGPGPYR-NQ----HVNRHHQHPHQH 529
            |..|||.| |......||:|.::|:|...|..|::  ..||..||. ||    .:.|.|...|: 
Mouse   252 LQIHKRTH-TGEKPYDCDECGKAFATRRHLQIHER--THTGEKPYECNQCGKAFIGRSHLQIHK- 312

  Fly   530 PLPHQPHLAATATSTCPAPPRESSESSSSAAAAAVAAMSTPPNPFLMFRTAPSFFPGFPPYGFPP 594
                :.|..        ..|.|.::                                        
Mouse   313 ----RVHTG--------EKPYECNQ---------------------------------------- 325

  Fly   595 FLPQNPLHPTNIPMFFSKNPMDLGCGGPEITSPVSAFDQKLPFGFLKGENSESQAYDK-VTEKEL 658
                                    ||        .||                 ||:. :...|:
Mouse   326 ------------------------CG--------KAF-----------------AYNSDLHRHEI 341

  Fly   659 VFKAEEKLKKEPLVQAFEGEEDESRSSLDIKGKLEDTRNDSKSEEQDDMKQEPERVSTPDQQQAE 723
            :...|:........:||     .:||||         ||   .||...:::              
Mouse   342 IHTGEKPYGCNQCGKAF-----ANRSSL---------RN---HEEHHTLEK-------------- 375

  Fly   724 DDRKSIDIMSTPPPADTPSGGDGPLDLSICRKRSAGSFFTAPAEDNLMLHRFMPRLHEFE----- 783
                                   |.:.::|.|..|..       .||.:|.   |.|..|     
Mouse   376 -----------------------PYECTLCGKAFAYC-------SNLYIHE---RCHTGEKPYVC 407

  Fly   784 AERGQPLKMRKSHSSAESSTSQKSHKGSSPTPTPTASPGLTPSPSPPTSAGGELSSTSEGGAVPT 848
            .:.|:.. .|:||....    ::.|.|..|                               .|.|
Mouse   408 TQCGKAF-ARRSHLHIH----ERCHTGEKP-------------------------------YVCT 436

  Fly   849 MAAAAFAADHSALASGPTLPQTHPTFHPLLLEEIYRSGFPFLCQPGGRRGI--EALLAGAASAAA 911
            ....|||.            .:|...|    |.|:....|:.|...|:..:  .:||....:...
Mouse   437 QCGKAFAR------------CSHLHVH----ERIHAGEKPYECNQCGKAFLLRSSLLIHERTHTG 485

  Fly   912 PKRPLPPVKFSAGSVVG----LKTKDR-------YSCKFCGKVFPRSANLTRHLRTHTGEQPYPC 965
            .|   |.|....|....    |:..:|       |.|..|.|.|...:||..|.||||||:||.|
Mouse   486 EK---PYVCNQCGKAFARQSHLQIHERSHTGEKPYECNQCSKAFVCRSNLQMHERTHTGERPYEC 547

  Fly   966 KYCDRAFSISSNLQRHVRNIHNKERPFRCELCDRSFGQQTNLDRHVKKHESEGNN--------FR 1022
            ..|.:|||..|.||:|.|: |:.|:|:.|..|.::|..:::|..|.|.|..|..|        |.
Mouse   548 NQCGKAFSRRSLLQKHERS-HSGEKPYACNQCGKAFASRSSLRNHEKHHNIEKPNECNQCAKAFT 611

  Fly  1023 DSPSSSGI 1030
            ..|.||.|
Mouse   612 SFPPSSNI 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hamNP_724130.4 PR-SET_ZFPM 131..253 CDD:380978
C2H2 Zn finger 341..363 CDD:275368 5/21 (24%)
C2H2 Zn finger 371..392 CDD:275368 8/20 (40%)
SFP1 <391..479 CDD:227516 36/87 (41%)
C2H2 Zn finger 400..421 CDD:275368 9/20 (45%)
SUF4-like 403..>445 CDD:411020 19/41 (46%)
C2H2 Zn finger 403..421 CDD:411020 8/17 (47%)
C2H2 Zn finger 429..449 CDD:275368 10/19 (53%)
C2H2 Zn finger 457..477 CDD:275368 9/19 (47%)
C2H2 Zn finger 486..504 CDD:275368 7/17 (41%)
PTZ00121 <641..>728 CDD:173412 14/87 (16%)
COG5048 935..>1028 CDD:227381 40/100 (40%)
zf-C2H2 935..957 CDD:395048 9/21 (43%)
C2H2 Zn finger 937..957 CDD:275368 8/19 (42%)
zf-H2C2_2 949..973 CDD:404364 14/23 (61%)
C2H2 Zn finger 965..986 CDD:275368 10/20 (50%)
C2H2 Zn finger 994..1014 CDD:275368 6/19 (32%)
Gm32687XP_011241923.1 KRAB 23..63 CDD:396083
C2H2 Zn finger 127..147 CDD:275368 5/21 (24%)
zf-H2C2_2 139..164 CDD:404364 7/26 (27%)
C2H2 Zn finger 155..175 CDD:275368 8/20 (40%)
COG5048 179..594 CDD:227381 144/640 (23%)
C2H2 Zn finger 183..203 CDD:275368 9/20 (45%)
C2H2 Zn finger 211..231 CDD:275368 10/19 (53%)
C2H2 Zn finger 239..259 CDD:275368 9/19 (47%)
C2H2 Zn finger 267..287 CDD:275368 7/21 (33%)
C2H2 Zn finger 295..315 CDD:275368 5/24 (21%)
C2H2 Zn finger 323..343 CDD:275368 7/108 (6%)
C2H2 Zn finger 351..367 CDD:275368 8/32 (25%)
C2H2 Zn finger 379..399 CDD:275368 7/29 (24%)
C2H2 Zn finger 407..427 CDD:275368 4/24 (17%)
C2H2 Zn finger 435..455 CDD:275368 7/35 (20%)
C2H2 Zn finger 463..483 CDD:275368 4/19 (21%)
C2H2 Zn finger 491..511 CDD:275368 3/19 (16%)
C2H2 Zn finger 519..539 CDD:275368 8/19 (42%)
C2H2 Zn finger 547..567 CDD:275368 10/20 (50%)
C2H2 Zn finger 575..595 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.