DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and ZNF264

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	NP_003408.1	Gene:	ZNF264 / 9422	HGNCID:	13057	Length:	627	Species:	Homo sapiens

Alignment Length:	167	Identity:	52/167 - (31%)
Similarity:	81/167 - (48%)	Gaps:	27/167 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            |.|..|||.|.|.:.||||.|.|:||:||:|..|.:||..|:||.||. .||..|:|:||..|.:
Human   483 YECVECGKAFTRMSGLTRHKRIHSGEKPYECVECGKSFCWSTNLIRHA-IIHTGEKPYKCSECGK 546

  Fly   376 CFGQQTNLDRHLKKHE-SDAVSLSALSGVSERMHCIRRFCENPTEESYFEEI--RSFMGKVTQQQ 437
            .|.:.::|.:|.:.|. .:.:|::.:.         |.|....|..:..|.:  :.|:...|:..
Human   547 AFSRSSSLTQHQRMHTGKNPISVTDVG---------RPFTSGQTSVTLRELLLGKDFLNVTTEAN 602

  Fly   438 QQQQQQQQHDQQQQQHQSTATSASSSCSSSRDTPTSS 474
            ...::             |::|||.. ...|:||..|
Human   603 ILPEE-------------TSSSASDQ-PYQRETPQVS 625

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	27/51 (53%)
		zf-C2H2	311..333	CDD:278523	12/21 (57%)
		C2H2 Zn finger	313..333	CDD:275368	11/19 (58%)
		zf-H2C2_2	325..349	CDD:290200	13/23 (57%)
		C2H2 Zn finger	341..362	CDD:275368	9/20 (45%)
		zf-H2C2_2	353..377	CDD:290200	11/23 (48%)
		zf-C2H2	368..390	CDD:278523	6/21 (29%)
		C2H2 Zn finger	370..390	CDD:275368	5/19 (26%)
ZNF264	NP_003408.1	KRAB	14..74	CDD:214630
		KRAB	14..53	CDD:279668
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	74..155
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	174..194
		COG5048	184..568	CDD:227381	37/85 (44%)
		C2H2 Zn finger	205..225	CDD:275368
		zf-H2C2_2	221..240	CDD:290200
		C2H2 Zn finger	233..253	CDD:275368
		zf-H2C2_2	245..270	CDD:290200
		C2H2 Zn finger	261..281	CDD:275368
		zf-H2C2_2	273..298	CDD:290200
		C2H2 Zn finger	289..309	CDD:275368
		C2H2 Zn finger	317..337	CDD:275368
		zf-C2H2	343..365	CDD:278523
		C2H2 Zn finger	345..365	CDD:275368
		zf-H2C2_2	357..380	CDD:290200
		C2H2 Zn finger	373..393	CDD:275368
		zf-C2H2	399..421	CDD:278523
		C2H2 Zn finger	401..421	CDD:275368
		zf-H2C2_2	413..438	CDD:290200
		C2H2 Zn finger	429..449	CDD:275368
		zf-H2C2_2	445..466	CDD:290200
		C2H2 Zn finger	457..477	CDD:275368
		zf-H2C2_2	469..494	CDD:290200	6/10 (60%)
		C2H2 Zn finger	485..505	CDD:275368	11/19 (58%)
		zf-H2C2_2	498..520	CDD:290200	12/21 (57%)
		C2H2 Zn finger	513..533	CDD:275368	9/20 (45%)
		zf-H2C2_2	525..550	CDD:290200	12/25 (48%)
		C2H2 Zn finger	541..561	CDD:275368	5/19 (26%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	605..627		8/35 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910