DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and Klf7

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_006496414.1 Gene:Klf7 / 93691 MGIID:1935151 Length:302 Species:Mus musculus


Alignment Length:252 Identity:67/252 - (26%)
Similarity:102/252 - (40%) Gaps:64/252 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 TPPQC---SIPAVHPTLLEAMTKNLPLQ----YRNVFAGVLPGK---VNSPAASSSPTGADFPFR 242
            :||.|   |...:.|.|       ||::    .::....:|..:   ::....|..||.:.....
Mouse    65 SPPPCIEESFRRLDPLL-------LPVEATICEKSSAVDILLSRDKLLSETCLSLQPTSSSLDSY 122

  Fly   243 HPLKKCELT-----WPPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAA-------- 294
            ..:.:.:|.     .||.:.:|...|...:..||.|       |.....|..|:.|:        
Mouse   123 TAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAV-------DGTVTLKLVAKKASLSSVKVGG 180

  Fly   295 ---------------------TGGNATPNLPQRNKDRYTCKF--CGKVFPRSANLTRHLRTHTG- 335
                                 .||......|:..|..:.|:|  |.||:.:|::|..|.||||| 
Mouse   181 VAAAAAVTPAGAVKSGQSDSEQGGGGADTCPENKKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGS 245

  Fly   336 EQPYKCKY--CERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKH 390
            |:||||.:  ||..|:.|..|.||.|. |...:||||..|:|||.:..:|..|:|:|
Mouse   246 EKPYKCSWEGCEWRFARSDELTRHYRK-HTGAKPFKCNHCDRCFSRSDHLALHMKRH 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 28/67 (42%)
zf-C2H2 311..333 CDD:278523 9/23 (39%)
C2H2 Zn finger 313..333 CDD:275368 9/21 (43%)
zf-H2C2_2 325..349 CDD:290200 14/26 (54%)
C2H2 Zn finger 341..362 CDD:275368 9/22 (41%)
zf-H2C2_2 353..377 CDD:290200 11/23 (48%)
zf-C2H2 368..390 CDD:278523 10/21 (48%)
C2H2 Zn finger 370..390 CDD:275368 8/19 (42%)
Klf7XP_006496414.1 KLF7_N 2..219 CDD:409244 28/167 (17%)
COG5048 <223..>281 CDD:227381 27/58 (47%)
C2H2 Zn finger 223..242 CDD:275368 7/18 (39%)
C2H2 Zn finger 251..273 CDD:275368 9/22 (41%)
zf-H2C2_2 265..290 CDD:404364 13/25 (52%)
zf-C2H2 279..301 CDD:395048 10/21 (48%)
C2H2 Zn finger 281..301 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.