DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and KLF4

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001300981.1 Gene:KLF4 / 9314 HGNCID:6348 Length:513 Species:Homo sapiens


Alignment Length:478 Identity:107/478 - (22%)
Similarity:164/478 - (34%) Gaps:181/478 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LGLIPTSYISHVPYDLASSASVAATSSSSTSPTTT---SATTTGRLQHQHSHQQHQTLNHHAKGK 85
            |..|.::.::|.|..:|::.|.:|::|||:||:::   ||.:|                      
Human   105 LDFILSNSLTHPPESVAATVSSSASASSSSSPSSSGPASAPST---------------------- 147

  Fly    86 RRSSFDQPLDLRLAHKRKTDLVDQGPMEDENSNLIMFASELA---------------------VA 129
              .||..|  :|..:       |.|.........:::..|.|                     ||
Human   148 --CSFTYP--IRAGN-------DPGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFVA 201

  Fly   130 QQKEKELNNNHI------------------AASLADLGFDMSRKMLRALREGGAGGG-------- 168
            :....||:..:|                  .|||:..|.:.....:.::.:|...|.        
Human   202 ELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPY 266

  Fly   169 GGGGGGGGGGGGPPNAPPLTPPQCSIPAVHPTLLEAMTKNLPLQYRNVFAGVLPGKVNSPAASSS 233
            .||             ||.|.|:....||.             ...::.||......:.|||...
Human   267 NGG-------------PPRTCPKIKQEAVS-------------SCTHLGAGPPLSNGHRPAAHDF 305

  Fly   234 PTGADFPFR----------------HPLKKCELTWPPPTEQLQLELPHPNPKLSPVLP---HPQL 279
            |.|...|.|                ||    .|..||...      |||.|.....||   .||:
Human   306 PLGRQLPSRTTPTLGLEEVLSSRDCHP----ALPLPPGFH------PHPGPNYPSFLPDQMQPQV 360

  Fly   280 QDYQTRRKNKARTAATG----------------------------GNATPNLPQRNKDR------ 310
            .....:.:::...|..|                            |:..|..|:..:.|      
Human   361 PPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRRSWPRK 425

  Fly   311 ----YTCKF--CGKVFPRSANLTRHLRTHTGEQPYKCKY--CERSFSISSNLQRHVRNIHNKERP 367
                :||.:  |||.:.:|::|..||||||||:||.|.:  |...|:.|..|.||.|. |...||
Human   426 RTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRK-HTGHRP 489

  Fly   368 FKCEICERCFGQQTNLDRHLKKH 390
            |:|:.|:|.|.:..:|..|:|:|
Human   490 FQCQKCDRAFSRSDHLALHMKRH 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 28/76 (37%)
zf-C2H2 311..333 CDD:278523 10/23 (43%)
C2H2 Zn finger 313..333 CDD:275368 9/21 (43%)
zf-H2C2_2 325..349 CDD:290200 13/25 (52%)
C2H2 Zn finger 341..362 CDD:275368 8/22 (36%)
zf-H2C2_2 353..377 CDD:290200 11/23 (48%)
zf-C2H2 368..390 CDD:278523 8/21 (38%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
KLF4NP_001300981.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..45
9aaTAD. /evidence=ECO:0000269|PubMed:31375868 101..109 1/3 (33%)
Interaction with ZNF296. /evidence=ECO:0000250|UniProtKB:Q60793 416..513 38/98 (39%)
COG5048 <425..508 CDD:227381 34/83 (41%)
zf-C2H2 430..454 CDD:278523 10/23 (43%)
C2H2 Zn finger 432..454 CDD:275368 9/21 (43%)
C2H2 Zn finger 462..484 CDD:275368 8/22 (36%)
Interaction with target DNA. /evidence=ECO:0000250 473..504 13/31 (42%)
zf-H2C2_2 476..501 CDD:290200 12/25 (48%)
C2H2 Zn finger 492..512 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.