DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and CMR3

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_015338.1 Gene:CMR3 / 856123 SGDID:S000006217 Length:317 Species:Saccharomyces cerevisiae


Alignment Length:193 Identity:53/193 - (27%)
Similarity:77/193 - (39%) Gaps:30/193 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 TPPQCSIP-AVHPTLLEAMTKNLPLQYRNVFAGVLPGKVNSPAASSSPTGADFPF-RHPLKKCEL 250
            |..|..|| :..|.|..:....:|:....|:..:.|........:|.|....... .||      
Yeast   134 TESQQPIPHSQSPHLTSSAPLMMPVMVPTVYKPLTPYDKEPITIASEPNFTAISMASHP------ 192

  Fly   251 TWPPPTEQLQLELPHPNPKLSP----VLPHPQLQDYQTRRKNKARTAATGGNA------TPNLPQ 305
                   ...|||.|..||..|    ||  |.:|:....|......|...|:|      |.....
Yeast   193 -------NAALELCHDRPKSVPPGYGVL--PTMQEASNGRTKSEPGAVLNGSATFSDWKTDTRIS 248

  Fly   306 RNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKY--CERSFSISSNLQRHVRNIHNKER 366
            ..|.|..|..|||:..|.:.|..|...|||:.|:||.:  |.:||::.||:.||::: |.::|
Yeast   249 STKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKS-HERKR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 23/64 (36%)
zf-C2H2 311..333 CDD:278523 7/21 (33%)
C2H2 Zn finger 313..333 CDD:275368 7/19 (37%)
zf-H2C2_2 325..349 CDD:290200 10/25 (40%)
C2H2 Zn finger 341..362 CDD:275368 8/22 (36%)
zf-H2C2_2 353..377 CDD:290200 5/14 (36%)
zf-C2H2 368..390 CDD:278523
C2H2 Zn finger 370..390 CDD:275368
CMR3NP_015338.1 COG5048 17..316 CDD:227381 53/193 (27%)
C2H2 Zn finger 256..276 CDD:275370 7/19 (37%)
C2H2 Zn finger 284..306 CDD:275370 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.