DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and ADR1

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_010502.3 Gene:ADR1 / 851802 SGDID:S000002624 Length:1323 Species:Saccharomyces cerevisiae


Alignment Length:302 Identity:62/302 - (20%)
Similarity:125/302 - (41%) Gaps:54/302 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 EQLQLELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQRNKDRYTCKFCGKVFP 321
            |:.::|:...:   ||:|    |......|:|         :.|.::.||..|       ||:..
Yeast    29 EKQEIEMETDD---SPIL----LMSSSASREN---------SNTFSVIQRTPD-------GKIIT 70

  Fly   322 RSANLTRHL---------------RTHTGE-QPYKCKYCERSFSISSNLQRHVRNIHNKERPFKC 370
            .:.|:...:               ||.:|: :.:.|:.|.|:|:...:|:||.|: |..|:|:.|
Yeast    71 TNNNMNSKINKQLDKLPENLRLNGRTPSGKLRSFVCEVCTRAFARQEHLKRHYRS-HTNEKPYPC 134

  Fly   371 EICERCFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCENPTEESYFE-------EIRS 428
            .:|.|||.::..|.||.:|..|..:. ..:|...:....|.:..:|......|:       :..:
Yeast   135 GLCNRCFTRRDLLIRHAQKIHSGNLG-ETISHTKKVSRTITKARKNSASSVKFQTPTYGTPDNGN 198

  Fly   429 FMGKVTQQQQQQQQQQQHDQQQQQHQST--ATSASSSCSSSRDTPTSSHEEADHAPATSTADTAA 491
            |:.:.|...:::...:.:.:::...:.|  |:.::.|.||......||.|:........:.....
Yeast   199 FLNRTTANTRRKASPEANVKRKYLKKLTRRASFSAQSASSYALPDQSSLEQHPKDRVKFSTPELV 263

  Fly   492 PSSSRDQEEEDSQPI---MELKRTLTSKL-FPTTTADSAMTT 529
            |...::.|.:.|..:   ::|...|.|.. .....:||:.:|
Yeast   264 PLDLKNPELDSSFDLNMNLDLNLNLDSNFNIALNRSDSSGST 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 18/78 (23%)
zf-C2H2 311..333 CDD:278523 4/36 (11%)
C2H2 Zn finger 313..333 CDD:275368 4/34 (12%)
zf-H2C2_2 325..349 CDD:290200 7/39 (18%)
C2H2 Zn finger 341..362 CDD:275368 8/20 (40%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 8/21 (38%)
C2H2 Zn finger 370..390 CDD:275368 8/19 (42%)
ADR1NP_010502.3 zf-C2H2 104..126 CDD:395048 8/22 (36%)
C2H2 Zn finger 106..126 CDD:275368 8/20 (40%)
zf-H2C2_2 118..143 CDD:404364 12/25 (48%)
C2H2 Zn finger 134..155 CDD:275368 9/20 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.