DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and ZNF528

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	XP_006723481.1	Gene:	ZNF528 / 84436	HGNCID:	29384	Length:	712	Species:	Homo sapiens

Alignment Length:	168	Identity:	57/168 - (33%)
Similarity:	81/168 - (48%)	Gaps:	28/168 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   271 SPVLPHPQLQDYQTRRKNKARTAATGG---NATPNLPQR---NKDR-YTCKFCGKVFPRSANLTR 328
            :|:||    |:.:...:.||......|   .|:.:|..:   |.|. |.|..|||||..|:.|..
Human   254 APLLP----QEQKAHIREKAYKCNEHGQVFRASASLTNQVIHNADNPYKCSECGKVFSCSSKLVI 314

  Fly   329 HLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRH------- 386
            |.|.||||:||||..|.:.||.:|||.:|.| ||..|:|:||..|::.|...:.|.:|
Human   315 HRRMHTGEKPYKCHECGKLFSSNSNLSQHQR-IHTGEKPYKCHECDKVFRSSSKLAQHQRIHTGE 378

  Fly   387 --LKKHESDAVSLSALSGVSERMHCIRRFCENPTEESY 422
              .|.||.|.|       .::..|.:|....:..|:.|
Human   379 KPYKCHECDKV-------FNQIAHLVRHQKIHTGEKPY 409

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	31/66 (47%)
		zf-C2H2	311..333	CDD:278523	11/21 (52%)
		C2H2 Zn finger	313..333	CDD:275368	10/19 (53%)
		zf-H2C2_2	325..349	CDD:290200	12/23 (52%)
		C2H2 Zn finger	341..362	CDD:275368	9/20 (45%)
		zf-H2C2_2	353..377	CDD:290200	11/23 (48%)
		zf-C2H2	368..390	CDD:278523	7/30 (23%)
		C2H2 Zn finger	370..390	CDD:275368	6/28 (21%)
ZNF528	XP_006723481.1	KRAB	8..68	CDD:214630
		KRAB	8..47	CDD:279668
		C2H2 Zn finger	272..291	CDD:275368	3/18 (17%)
		COG5048	277..712	CDD:227381	50/141 (35%)
		C2H2 Zn finger	299..319	CDD:275368	10/19 (53%)
		zf-H2C2_2	312..336	CDD:290200	13/23 (57%)
		C2H2 Zn finger	327..347	CDD:275368	9/20 (45%)
		zf-H2C2_2	339..364	CDD:290200	12/25 (48%)
		C2H2 Zn finger	355..375	CDD:275368	5/19 (26%)
		zf-H2C2_2	368..392	CDD:290200	7/30 (23%)
		C2H2 Zn finger	383..403	CDD:275368	6/26 (23%)
		zf-H2C2_2	395..420	CDD:290200	4/15 (27%)
		C2H2 Zn finger	411..431	CDD:275368
		zf-H2C2_2	423..447	CDD:290200
		C2H2 Zn finger	439..459	CDD:275368
		C2H2 Zn finger	467..487	CDD:275368
		C2H2 Zn finger	495..515	CDD:275368
		C2H2 Zn finger	523..543	CDD:275368
		zf-H2C2_2	535..560	CDD:290200
		C2H2 Zn finger	551..571	CDD:275368
		zf-H2C2_2	563..588	CDD:290200
		C2H2 Zn finger	579..599	CDD:275368
		zf-H2C2_2	591..616	CDD:290200
		C2H2 Zn finger	607..627	CDD:275368
		zf-H2C2_2	619..642	CDD:290200
		C2H2 Zn finger	635..655	CDD:275368
		C2H2 Zn finger	663..683	CDD:275368
		zf-H2C2_2	675..700	CDD:290200
		C2H2 Zn finger	691..711	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910