DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and Klf5

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_445846.3 Gene:Klf5 / 84410 RGDID:621446 Length:443 Species:Rattus norvegicus


Alignment Length:218 Identity:69/218 - (31%)
Similarity:104/218 - (47%) Gaps:32/218 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 NAPPLTPPQCSIPAVHPTLLEAMTKNLPLQYRNVFAGVLPGKVNSPAASSSPTGADFPFRHPLKK 247
            |:.|...||.|:.....  :...|..:|.|:....|...|     |:..||..|:  |.|.....
  Rat   250 NSHPSAVPQTSMKQFQG--MPPCTYTMPSQFLPQQATYFP-----PSPPSSEPGS--PDRQAEML 305

  Fly   248 CELTWPPPT--EQLQLELPHPNPKLSPVLP--HPQLQDYQTRRKNKARTAATGGNATPNLPQRNK 308
            ..|| |||:  ..:..:|...||.|...||  .|.:|..:..|:           :.|:|.:|. 
  Rat   306 QNLT-PPPSYAATIASKLAIHNPNLPATLPVNSPNIQPVRYNRR-----------SNPDLEKRR- 357

  Fly   309 DRYTCKF--CGKVFPRSANLTRHLRTHTGEQPYKCKY--CERSFSISSNLQRHVRNIHNKERPFK 369
             .:.|.:  |.||:.:|::|..||||||||:||||.:  |:..|:.|..|.||.|. |...:||:
  Rat   358 -IHFCDYDGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRK-HTGAKPFQ 420

  Fly   370 CEICERCFGQQTNLDRHLKKHES 392
            |.:|.|.|.:..:|..|:|:|::
  Rat   421 CVVCNRSFSRSDHLALHMKRHQN 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 28/66 (42%)
zf-C2H2 311..333 CDD:278523 9/23 (39%)
C2H2 Zn finger 313..333 CDD:275368 9/21 (43%)
zf-H2C2_2 325..349 CDD:290200 14/25 (56%)
C2H2 Zn finger 341..362 CDD:275368 8/22 (36%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 8/21 (38%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
Klf5NP_445846.3 KLF5_N 3..356 CDD:410335 32/126 (25%)
COG5048 345..>419 CDD:227381 30/87 (34%)
C2H2 Zn finger 361..383 CDD:275368 9/21 (43%)
C2H2 Zn finger 391..413 CDD:275368 8/22 (36%)
zf-H2C2_2 405..430 CDD:404364 11/25 (44%)
zf-C2H2 419..441 CDD:395048 8/21 (38%)
C2H2 Zn finger 421..441 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.