| Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001358837.1 | Gene: | GFI1B / 8328 | HGNCID: | 4238 | Length: | 352 | Species: | Homo sapiens |
| Alignment Length: | 233 | Identity: | 58/233 - (24%) |
|---|---|---|---|
| Similarity: | 97/233 - (41%) | Gaps: | 23/233 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 178 GGGP-PNAPPLTPPQCSIPAVHPTLLEAMTKNLPLQYRNVFAGVLPGKVNSPAASSSPTGADFPF 241
Fly 242 RHP-------LKKCELTWPPPTEQLQLELPHPNPKLSP--------VLPHPQLQDYQTRRKNKAR 291
Fly 292 TAATGGNATPNLP----QRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISS 352
Fly 353 NLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKH 390 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 22/66 (33%) |
| zf-C2H2 | 311..333 | CDD:278523 | 10/21 (48%) | ||
| C2H2 Zn finger | 313..333 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 8/23 (35%) | ||
| C2H2 Zn finger | 341..362 | CDD:275368 | 5/20 (25%) | ||
| zf-H2C2_2 | 353..377 | CDD:290200 | 8/23 (35%) | ||
| zf-C2H2 | 368..390 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 7/19 (37%) | ||
| GFI1B | NP_001358837.1 | C2H2 Zn finger | 165..186 | CDD:275368 | 4/21 (19%) |
| C2H2 Zn finger | 194..214 | CDD:275368 | 2/19 (11%) | ||
| C2H2 Zn finger | 244..264 | CDD:275368 | 10/19 (53%) | ||
| COG5048 | 252..>329 | CDD:227381 | 27/70 (39%) | ||
| C2H2 Zn finger | 272..292 | CDD:275368 | 5/20 (25%) | ||
| zf-H2C2_2 | 284..309 | CDD:372612 | 9/25 (36%) | ||
| C2H2 Zn finger | 300..320 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 328..345 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||