| Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001229823.1 | Gene: | ZKSCAN3 / 80317 | HGNCID: | 13853 | Length: | 538 | Species: | Homo sapiens |
| Alignment Length: | 269 | Identity: | 70/269 - (26%) |
|---|---|---|---|
| Similarity: | 113/269 - (42%) | Gaps: | 77/269 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 254 PPTEQLQLELPH-PNPKLS----------PVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQRN 307
Fly 308 KDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEI 372
Fly 373 CERCFGQQTNLDRHLKKHESD------------AVSLSALSGVSERMHCIRRFCENPTEESYFEE 425
Fly 426 IRSFMGKVTQQ-----------------QQQQQQQQQHDQQQQQHQSTATSASSSC-----SSSR 468
Fly 469 DTPTSSHEE 477 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 24/62 (39%) |
| zf-C2H2 | 311..333 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 313..333 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 341..362 | CDD:275368 | 8/20 (40%) | ||
| zf-H2C2_2 | 353..377 | CDD:290200 | 9/23 (39%) | ||
| zf-C2H2 | 368..390 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 6/19 (32%) | ||
| ZKSCAN3 | NP_001229823.1 | SCAN | 42..154 | CDD:128708 | |
| SCAN | 42..130 | CDD:280241 | |||
| KRAB | 214..274 | CDD:214630 | 6/13 (46%) | ||
| KRAB | 217..252 | CDD:279668 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 226..274 | 6/13 (46%) | |||
| zf-C2H2 | 314..336 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 316..336 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 329..351 | CDD:290200 | 11/21 (52%) | ||
| C2H2 Zn finger | 344..364 | CDD:275368 | 8/20 (40%) | ||
| zf-H2C2_2 | 356..381 | CDD:290200 | 10/25 (40%) | ||
| COG5048 | <368..515 | CDD:227381 | 27/146 (18%) | ||
| C2H2 Zn finger | 372..392 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 384..409 | CDD:290200 | 3/24 (13%) | ||
| C2H2 Zn finger | 400..420 | CDD:275368 | 4/21 (19%) | ||
| zf-H2C2_2 | 412..437 | CDD:290200 | 9/37 (24%) | ||
| C2H2 Zn finger | 428..448 | CDD:275368 | 3/19 (16%) | ||
| zf-C2H2 | 480..502 | CDD:278523 | 4/21 (19%) | ||
| C2H2 Zn finger | 482..502 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 495..519 | CDD:290200 | 1/6 (17%) | ||
| C2H2 Zn finger | 510..530 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||