DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and ZKSCAN3

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001229823.1 Gene:ZKSCAN3 / 80317 HGNCID:13853 Length:538 Species:Homo sapiens


Alignment Length:269 Identity:70/269 - (26%)
Similarity:113/269 - (42%) Gaps:77/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 PPTEQLQLELPH-PNPKLS----------PVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQRN 307
            ||.|    |||. .:.|:|          |.......|:.:.:||.|   .||||.         
Human   264 PPAE----ELPEKEHGKISCHLREDIAQIPTCAEAGEQEGRLQRKQK---NATGGR--------- 312

  Fly   308 KDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEI 372
              |:.|..|||.|.:|:.|::|.|.||||:||:|:.|.::|..||.|..|.| :|..|:|::||.
Human   313 --RHICHECGKSFAQSSGLSKHRRIHTGEKPYECEECGKAFIGSSALVIHQR-VHTGEKPYECEE 374

  Fly   373 CERCFGQQTNLDRHLKKHESD------------AVSLSALSGVSERMHCIRRFCENPTEESYFEE 425
            |.:.|...::|.:|.:.|..:            :.|.|.|.  ..|:|         |.|..:: 
Human   375 CGKAFSHSSDLIKHQRTHTGEKPYECDDCGKTFSQSCSLLE--HHRIH---------TGEKPYQ- 427

  Fly   426 IRSFMGKVTQQ-----------------QQQQQQQQQHDQQQQQHQSTATSASSSC-----SSSR 468
             .|..||..::                 |:.:|.:....:.:.|.::..|..|..|     |.::
Human   428 -CSMCGKAFRRSSHLLRHQRIHTGDKNVQEPEQGEAWKSRMESQLENVETPMSYKCNECERSFTQ 491

  Fly   469 DTPTSSHEE 477
            :|....|::
Human   492 NTGLIEHQK 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 24/62 (39%)
zf-C2H2 311..333 CDD:278523 9/21 (43%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 11/23 (48%)
C2H2 Zn finger 341..362 CDD:275368 8/20 (40%)
zf-H2C2_2 353..377 CDD:290200 9/23 (39%)
zf-C2H2 368..390 CDD:278523 6/21 (29%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
ZKSCAN3NP_001229823.1 SCAN 42..154 CDD:128708
SCAN 42..130 CDD:280241
KRAB 214..274 CDD:214630 6/13 (46%)
KRAB 217..252 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..274 6/13 (46%)
zf-C2H2 314..336 CDD:278523 9/21 (43%)
C2H2 Zn finger 316..336 CDD:275368 9/19 (47%)
zf-H2C2_2 329..351 CDD:290200 11/21 (52%)
C2H2 Zn finger 344..364 CDD:275368 8/20 (40%)
zf-H2C2_2 356..381 CDD:290200 10/25 (40%)
COG5048 <368..515 CDD:227381 27/146 (18%)
C2H2 Zn finger 372..392 CDD:275368 6/19 (32%)
zf-H2C2_2 384..409 CDD:290200 3/24 (13%)
C2H2 Zn finger 400..420 CDD:275368 4/21 (19%)
zf-H2C2_2 412..437 CDD:290200 9/37 (24%)
C2H2 Zn finger 428..448 CDD:275368 3/19 (16%)
zf-C2H2 480..502 CDD:278523 4/21 (19%)
C2H2 Zn finger 482..502 CDD:275368 4/19 (21%)
zf-H2C2_2 495..519 CDD:290200 1/6 (17%)
C2H2 Zn finger 510..530 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.