DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and ZNF671

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	NP_079109.2	Gene:	ZNF671 / 79891	HGNCID:	26279	Length:	534	Species:	Homo sapiens

Alignment Length:	133	Identity:	43/133 - (32%)
Similarity:	58/133 - (43%)	Gaps:	33/133 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVR---------------- 359
            |.|..|||.|.|...|..|.||||||:||:|..|.::||.||:|..|.|
Human   397 YVCSECGKEFSRKHTLVLHQRTHTGERPYECSECGKAFSQSSHLNVHWRIHSSDYECSRCGKAFS 461

  Fly   360 ---------NIHNKERPFKCEICERCFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCE 415
                     .:|:.|:|::|..|.:.|.|:.||.||.|.|..:...:.:        .|.|.|..
Human   462 CISKLIQHQKVHSGEKPYECSKCGKAFTQRPNLIRHWKVHTGERPYVCS--------ECGREFIR 518

  Fly   416 NPT 418
            ..|
Human   519 KQT 521

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	26/76 (34%)
		zf-C2H2	311..333	CDD:278523	10/21 (48%)
		C2H2 Zn finger	313..333	CDD:275368	9/19 (47%)
		zf-H2C2_2	325..349	CDD:290200	12/23 (52%)
		C2H2 Zn finger	341..362	CDD:275368	9/45 (20%)
		zf-H2C2_2	353..377	CDD:290200	8/48 (17%)
		zf-C2H2	368..390	CDD:278523	9/21 (43%)
		C2H2 Zn finger	370..390	CDD:275368	9/19 (47%)
ZNF671	NP_079109.2	KRAB	49..109	CDD:214630
		KRAB	49..88	CDD:279668
		C2H2 Zn finger	243..269	CDD:275368
		COG5048	<285..443	CDD:227381	24/45 (53%)
		zf-C2H2	285..307	CDD:278523
		C2H2 Zn finger	287..307	CDD:275368
		zf-H2C2_2	300..324	CDD:290200
		C2H2 Zn finger	315..335	CDD:275368
		zf-H2C2_2	327..352	CDD:290200
		C2H2 Zn finger	343..363	CDD:275368
		zf-C2H2	369..391	CDD:278523
		C2H2 Zn finger	371..391	CDD:275368
		zf-C2H2	397..419	CDD:278523	10/21 (48%)
		C2H2 Zn finger	399..419	CDD:275368	9/19 (47%)
		zf-H2C2_2	412..436	CDD:290200	13/23 (57%)
		C2H2 Zn finger	427..447	CDD:275368	9/19 (47%)
		C2H2 Zn finger	453..473	CDD:275368	0/19 (0%)
		zf-H2C2_2	466..490	CDD:290200	6/23 (26%)
		C2H2 Zn finger	481..501	CDD:275368	9/19 (47%)
		C2H2 Zn finger	509..529	CDD:275368	4/21 (19%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910