DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and zgc:175107

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001107104.1 Gene:zgc:175107 / 794317 ZFINID:ZDB-GENE-080220-38 Length:333 Species:Danio rerio


Alignment Length:167 Identity:52/167 - (31%)
Similarity:80/167 - (47%) Gaps:19/167 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 TEQLQLE----LPHPNPKLSPVLPHPQLQDYQT-----RRKNKARTAATGGNATP-------NLP 304
            :|.|::|    :.|.:......|..|:::..:|     |.:...|.:|.|..:|.       ..|
Zfish     8 SEDLKIEHTFTVKHEDRDKQTDLTAPKVERQETNELEERNQYDKRDSAIGEKSTHTQDASLLKRP 72

  Fly   305 Q--RNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERP 367
            |  .:...|.|..|.|.|....||..|.||||||:|:.|:.|.:|||...||:.|:| :|..|:|
Zfish    73 QSAESSGYYICGECNKSFGLKQNLEVHKRTHTGEKPFSCQQCGKSFSQKQNLKVHMR-VHTGEKP 136

  Fly   368 FKCEICERCFGQQTNLDRHLKKHESDAVSLSALSGVS 404
            |.|..|.:.|..:.||..|::.|..::..:..|.|.|
Zfish   137 FSCPFCGQNFTHKGNLKTHVRNHTGESAFICNLCGKS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 27/71 (38%)
zf-C2H2 311..333 CDD:278523 9/21 (43%)
C2H2 Zn finger 313..333 CDD:275368 8/19 (42%)
zf-H2C2_2 325..349 CDD:290200 13/23 (57%)
C2H2 Zn finger 341..362 CDD:275368 9/20 (45%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 7/21 (33%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
zgc:175107NP_001107104.1 C2H2 Zn finger 83..103 CDD:275368 8/19 (42%)
zf-H2C2_2 95..120 CDD:290200 14/24 (58%)
COG5048 <107..286 CDD:227381 24/68 (35%)
C2H2 Zn finger 111..131 CDD:275368 9/20 (45%)
zf-H2C2_2 123..148 CDD:290200 11/25 (44%)
C2H2 Zn finger 139..159 CDD:275368 6/19 (32%)
zf-C2H2 165..187 CDD:278523 3/9 (33%)
C2H2 Zn finger 167..187 CDD:275368 3/7 (43%)
C2H2 Zn finger 195..215 CDD:275368
C2H2 Zn finger 223..243 CDD:275368
C2H2 Zn finger 251..271 CDD:275368
zf-H2C2_2 264..287 CDD:290200
C2H2 Zn finger 279..299 CDD:275368
zf-H2C2_2 291..316 CDD:290200
C2H2 Zn finger 307..324 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.