Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001920652.2 | Gene: | klf6b / 793760 | ZFINID: | ZDB-GENE-070912-633 | Length: | 245 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 57/196 - (29%) |
---|---|---|---|
Similarity: | 82/196 - (41%) | Gaps: | 61/196 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 230 ASSSPTGADFP-------------------------FRHPL------KKCELTWPPPTEQLQLEL 263
Fly 264 PHPNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQRNKDRYTCKF--CGKVFPRSANL 326
Fly 327 TRHLRTHTGEQPYKCKY--CERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKK 389
Fly 390 H 390 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 26/66 (39%) |
zf-C2H2 | 311..333 | CDD:278523 | 9/23 (39%) | ||
C2H2 Zn finger | 313..333 | CDD:275368 | 9/21 (43%) | ||
zf-H2C2_2 | 325..349 | CDD:290200 | 13/25 (52%) | ||
C2H2 Zn finger | 341..362 | CDD:275368 | 9/22 (41%) | ||
zf-H2C2_2 | 353..377 | CDD:290200 | 11/23 (48%) | ||
zf-C2H2 | 368..390 | CDD:278523 | 10/21 (48%) | ||
C2H2 Zn finger | 370..390 | CDD:275368 | 8/19 (42%) | ||
klf6b | XP_001920652.2 | C2H2 Zn finger | 167..186 | CDD:275368 | 7/18 (39%) |
COG5048 | 176..>227 | CDD:227381 | 25/51 (49%) | ||
C2H2 Zn finger | 194..216 | CDD:275368 | 9/22 (41%) | ||
zf-C2H2 | 222..244 | CDD:306579 | 10/21 (48%) | ||
C2H2 Zn finger | 224..244 | CDD:275368 | 8/19 (42%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |