DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and klf7

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001072934.1 Gene:klf7 / 780396 XenbaseID:XB-GENE-1012735 Length:296 Species:Xenopus tropicalis


Alignment Length:220 Identity:69/220 - (31%)
Similarity:96/220 - (43%) Gaps:72/220 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 PPNAPPLT-----PPQCSIPAVHPTL-LEAMTKNLPLQYRNVFAGVLPGKVNSPAASSSPTGADF 239
            ||::|.|:     .|| |:.||..|: |:.:.|.         |.|..||    ||.|:.|..  
 Frog   138 PPSSPELSRHLVKTPQ-SLSAVDGTVTLKLVAKK---------ASVSLGK----AAESASTAV-- 186

  Fly   240 PFRHPLKKCELTWPPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNLP 304
                 ..||.|:   .:||                                    |||....: |
 Frog   187 -----TSKCGLS---DSEQ------------------------------------TGGPGEAS-P 206

  Fly   305 QRNKDRYTCKF--CGKVFPRSANLTRHLRTHTGEQPYKCKY--CERSFSISSNLQRHVRNIHNKE 365
            :..|..:.|:|  |.||:.:|::|..|.||||||:||||.:  ||..|:.|..|.||.|. |...
 Frog   207 ENKKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRK-HTGA 270

  Fly   366 RPFKCEICERCFGQQTNLDRHLKKH 390
            :||||..|:|||.:..:|..|:|:|
 Frog   271 KPFKCNHCDRCFSRSDHLALHMKRH 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 28/66 (42%)
zf-C2H2 311..333 CDD:278523 9/23 (39%)
C2H2 Zn finger 313..333 CDD:275368 9/21 (43%)
zf-H2C2_2 325..349 CDD:290200 14/25 (56%)
C2H2 Zn finger 341..362 CDD:275368 9/22 (41%)
zf-H2C2_2 353..377 CDD:290200 11/23 (48%)
zf-C2H2 368..390 CDD:278523 10/21 (48%)
C2H2 Zn finger 370..390 CDD:275368 8/19 (42%)
klf7NP_001072934.1 COG5048 193..>278 CDD:227381 38/125 (30%)
C2H2 Zn finger 218..237 CDD:275368 7/18 (39%)
C2H2 Zn finger 245..267 CDD:275368 9/22 (41%)
zf-C2H2 273..295 CDD:333835 10/21 (48%)
C2H2 Zn finger 275..295 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.